KPNA2 Antikörper (N-Term)
-
- Target Alle KPNA2 Antikörper anzeigen
- KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))
-
Bindungsspezifität
- AA 2-46, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KPNA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Importin subunit alpha-1(KPNA2) detection. Tested with WB in Human.
- Sequenz
- STNENANTPA ARLHRFKNKG KDSTEMRRRR IEVNVELRKA KKDDQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Importin subunit alpha-1(KPNA2) detection. Tested with WB in Human.
Gene Name: karyopherin subunit alpha 2
Protein Name: Importin subunit alpha-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human KPNA2 (2-46aa STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ), different from the related mouse sequence by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product KPNA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))
- Andere Bezeichnung
- KPNA2 (KPNA2 Produkte)
- Synonyme
- IPOA1 antikoerper, QIP2 antikoerper, RCH1 antikoerper, SRP1alpha antikoerper, ima2 antikoerper, importin antikoerper, 2410044B12Rik antikoerper, PTAC58 antikoerper, Rch1 antikoerper, ipoa1 antikoerper, kpna2 antikoerper, qip2 antikoerper, rch1 antikoerper, srp1alpha antikoerper, hm:zeh0389 antikoerper, hm:zeh0389r antikoerper, zgc:113902 antikoerper, zgc:86945 antikoerper, karyopherin subunit alpha 2 antikoerper, importin subunit alpha-2 antikoerper, Importin subunit alpha-2 antikoerper, karyopherin (importin) alpha 2 antikoerper, karyopherin alpha-2 subunit like L homeolog antikoerper, karyopherin alpha 2 (RAG cohort 1, importin alpha 1) antikoerper, KPNA2 antikoerper, EDI_246290 antikoerper, EDI_335040 antikoerper, ima2 antikoerper, Kpna2 antikoerper, kpna2.L antikoerper, kpna2 antikoerper
- Hintergrund
-
Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination.
Synonyms: Importin subunit alpha-1, Karyopherin subunit alpha-2, RAG cohort protein 1, SRP1-alpha, KPNA2, RCH1, SRP1 - Gen-ID
- 3838
- UniProt
- P52292
- Pathways
- M Phase, Protein targeting to Nucleus
-