HCN2 Antikörper (C-Term)

Produktnummer ABIN5518840

Produktdetails anti-HCN2 Antikörper

Target: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Bindungsspezifität: AA 682-714, C-Term

Reaktivität: Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HCN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2(HCN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: VFNNQENAII QEIVKYDREM VQQAELGQRV GLF

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2(HCN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hyperpolarization activated cyclic nucleotide gated potassium channel 2
Protein Name: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HCN2 (682-714aa VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HCN2

Target: HCN2 (Hyperpolarization Activated Cyclic Nucleotide-Gated Potassium Channel 2 (HCN2))

Andere Bezeichnung: HCN2 (HCN2 Produkte)

Synonyme: HCN2 antikoerper, BCNG-2 antikoerper, BCNG2 antikoerper, HAC-1 antikoerper, HAC1 antikoerper, trls antikoerper, hyperpolarization activated cyclic nucleotide-gated potassium channel 2 antikoerper, hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 antikoerper, hyperpolarization-activated, cyclic nucleotide-gated K+ 2 antikoerper, LOC428335 antikoerper, HCN2 antikoerper, Hcn2 antikoerper

Hintergrund: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.

Synonyms: BCNG-2 | BCNG2 | HAC1 | Hcn2 | Q9UL51

Gen-ID: 610