DVL1 Antikörper (Middle Region)
-
- Target Alle DVL1 Antikörper anzeigen
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
-
Bindungsspezifität
- AA 401-438, Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DVL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-1(DVL1) detection. Tested with WB, IHC-P in Human,Rat.
- Sequenz
- APQLEEAPLT VKSDMSAVVR VMQLPDSGLE IRDRMWLK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-1(DVL1) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: dishevelled segment polarity protein 1
Protein Name: Segment polarity protein dishevelled homolog DVL-1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product DVL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
- Andere Bezeichnung
- DVL1 (DVL1 Produkte)
- Synonyme
- DVL antikoerper, DVL1L1 antikoerper, DVL1P1 antikoerper, Dvl antikoerper, mKIAA4029 antikoerper, dvl-1 antikoerper, DSH antikoerper, DVL-1 antikoerper, dvl1 antikoerper, dvl2l antikoerper, Xdsh antikoerper, dsh1 antikoerper, dishevelled segment polarity protein 1 antikoerper, dishevelled, dsh homolog 1 (Drosophila) antikoerper, microRNA 6808 antikoerper, dishevelled segment polarity protein 1b antikoerper, dishevelled segment polarity protein 1 L homeolog antikoerper, DVL1 antikoerper, Dvl1 antikoerper, MIR6808 antikoerper, dvl1b antikoerper, dvl1.L antikoerper
- Hintergrund
-
Segment polarity protein dishevelled homolog DVL-1 is a protein that in humans is encoded by the DVL1 gene. DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
Synonyms: Dishevelled 1 | Dishevelled | Dishevelled-1 | Dishevelled1 | DSH homolog 1 | Dvl 1 | Dvl | Dvl1 | DVL1L1 | DVL1P1 | DRS2 | O14640 - Gen-ID
- 1855
- UniProt
- O14640
- Pathways
- WNT Signalweg, Synaptic Membrane, Skeletal Muscle Fiber Development
-