Leptin Receptor Antikörper (C-Term)

Produktnummer ABIN5518771

Produktdetails anti-Leptin Receptor Antikörper

Target: Leptin Receptor (LEPR)

Bindungsspezifität: AA 793-839, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Leptin Receptor Antikörper ist unkonjugiert

Applikation: ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.

Sequenz: KKYYIHDHFI PIEKYQFSLY PIFMEGVGKP KIINSFTQDD IEKHQSD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Leptin receptor(LEPR) detection. Tested with IHC-P, ELISA in Human,Mouse,Rat.
Gene Name: leptin receptor
Protein Name: Leptin receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eight amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Leptin Receptor Antikörper (ABIN5518771)

Tu, Kuang, Gong, Shi, Yu, Shi, Wang, Sun: "The Influence of LepR Tyrosine Site Mutations on Mouse Ovary Development and Related Gene Expression Changes." in: PLoS ONE, Vol. 10, Issue 11, pp. e0141800, (2016) (PubMed).

Details zu Leptin Receptor

Target: Leptin Receptor (LEPR)

Andere Bezeichnung: LEPR (LEPR Produkte)

Synonyme: CD295 antikoerper, LEP-R antikoerper, LEPRD antikoerper, OB-R antikoerper, OBR antikoerper, obr antikoerper, cd295 antikoerper, ob-rb antikoerper, Fa antikoerper, LEPROT antikoerper, Leprb antikoerper, Modb1 antikoerper, OB-RGRP antikoerper, Obr antikoerper, db antikoerper, diabetes antikoerper, obese-like antikoerper, obl antikoerper, ObRb antikoerper, Ob-R antikoerper, Ob-RM antikoerper, lepr antikoerper, leptin receptor antikoerper, leptin receptor S homeolog antikoerper, LEPR antikoerper, lepr antikoerper, Lepr antikoerper, lepr.S antikoerper

Hintergrund: Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Synonyms: CD295 | DB | OBR | Fa | Obr | HuB219 | LEP R | LEPR | LEP-R | LEPRD | LEPROT | Leptin receptor | OB R | OB receptor | OB-R | OBRGRP | OB-RGRP | P48357

Gen-ID: 3953

UniProt: P48357

Pathways: JAK-STAT Signalweg, AMPK Signaling, Feeding Behaviour