Unc5c Antikörper
-
- Target Alle Unc5c Antikörper anzeigen
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Unc5c Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product Unc5c Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the UNC5C antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the UNC5C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
- Andere Bezeichnung
- UNC5C (Unc5c Produkte)
- Synonyme
- UNC5C antikoerper, UNC5H3 antikoerper, 6030473H24 antikoerper, AI047720 antikoerper, B130051O18Rik antikoerper, Unc5h3 antikoerper, rcm antikoerper, wu:fb03d07 antikoerper, unc-5 netrin receptor C antikoerper, UNC5C antikoerper, Unc5c antikoerper, unc5c antikoerper
- Hintergrund
- Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
- UniProt
- O95185
-