UBE2Q2 Antikörper

Produktnummer ABIN4953007

Produktdetails anti-UBE2Q2 Antikörper

Target: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2Q2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the UBE2Q2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the UBE2Q2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu UBE2Q2

Target: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Andere Bezeichnung: UBE2Q2 (UBE2Q2 Produkte)

Synonyme: 3010021M21Rik antikoerper, zgc:56219 antikoerper, wu:fi34a03 antikoerper, RGD1307680 antikoerper, ube2q2 antikoerper, ubiquitin conjugating enzyme E2 Q2 antikoerper, ubiquitin-conjugating enzyme E2Q family member 2 antikoerper, ubiquitin-conjugating enzyme E2 Q2 antikoerper, ubiquitin conjugating enzyme E2Q family member 2 L homeolog antikoerper, UBE2Q2 antikoerper, Ube2q2 antikoerper, CpipJ_CPIJ007726 antikoerper, PTRG_02494 antikoerper, MGYG_01328 antikoerper, ube2q2 antikoerper, ube2q2.L antikoerper

Hintergrund: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. It can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.

UniProt: Q8WVN8