UBE2Q2 Antikörper (N-Term)

Produktnummer ABIN3043953

Produktdetails anti-UBE2Q2 Antikörper

Target: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Bindungsspezifität: AA 83-123, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2Q2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Ubiquitin-conjugating enzyme E2 Q2(UBE2Q2) detection. Tested with WB, IHC-P in Human.

Sequenz: LERLEDTKNN NLLRQQLKWL ICELCSLYNL PKHLDVEMLD Q

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ubiquitin-conjugating enzyme E2 Q2(UBE2Q2) detection. Tested with WB, IHC-P in Human.
Gene Name: ubiquitin conjugating enzyme E2Q family member 2
Protein Name: Ubiquitin-conjugating enzyme E2 Q2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu UBE2Q2

Target: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Andere Bezeichnung: UBE2Q2 (UBE2Q2 Produkte)

Synonyme: 3010021M21Rik antikoerper, zgc:56219 antikoerper, wu:fi34a03 antikoerper, RGD1307680 antikoerper, ube2q2 antikoerper, ubiquitin conjugating enzyme E2 Q2 antikoerper, ubiquitin-conjugating enzyme E2Q family member 2 antikoerper, ubiquitin-conjugating enzyme E2 Q2 antikoerper, ubiquitin conjugating enzyme E2Q family member 2 L homeolog antikoerper, UBE2Q2 antikoerper, Ube2q2 antikoerper, CpipJ_CPIJ007726 antikoerper, PTRG_02494 antikoerper, MGYG_01328 antikoerper, ube2q2 antikoerper, ube2q2.L antikoerper

Hintergrund: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. UBE2Q2 can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.

Synonyms: LOC92912 antibody|UB2Q2_HUMAN antibody|UBE2Q2 antibody|Ubiquitin carrier protein Q2 antibody|Ubiquitin conjugating enzyme E2Q 2 antibody|Ubiquitin conjugating enzyme E2Q family member 2 antibody|Ubiquitin-conjugating enzyme E2 Q2 antibody|ubiquitin-conjugating enzyme E2Q (putative) 2 antibody|Ubiquitin-protein ligase Q2 antibody

Gen-ID: 92912