Transferrin Antikörper

Produktnummer ABIN4952904

Produktdetails anti-Transferrin Antikörper

Target: Transferrin (TF)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Transferrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids VPDKTVRWCAVSEHEATKCQSFRDHMKSVI of human Transferrin were used as the immunogen for the Transferrin antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Transferrin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Transferrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Transferrin

Target: Transferrin (TF)

Andere Bezeichnung: Transferrin (TF Produkte)

Synonyme: ltf antikoerper, pro1557 antikoerper, pro2086 antikoerper, mgc107777 antikoerper, LOC692564 antikoerper, TF antikoerper, LOC100144362 antikoerper, tf antikoerper, LTF antikoerper, TFEW antikoerper, conalbumin antikoerper, tf-b antikoerper, MGC64306 antikoerper, PRO1557 antikoerper, PRO2086 antikoerper, TFQTL1 antikoerper, AI266983 antikoerper, Cd176 antikoerper, HP antikoerper, Tf antikoerper, Tfn antikoerper, hpx antikoerper, Trf antikoerper, cb285 antikoerper, gavi antikoerper, id:ibd3238 antikoerper, id:ibd3525 antikoerper, sb:cb285 antikoerper, wu:fb57g06 antikoerper, wu:fb62h02 antikoerper, wu:fb63h10 antikoerper, wu:fb64h10 antikoerper, zgc:112154 antikoerper, 143958_at antikoerper, CG6186 antikoerper, Dmel\\CG6186 antikoerper, TSF1 antikoerper, anon-EST:Posey265 antikoerper, tsf1 antikoerper, Pro-TRH antikoerper, IL-5 antikoerper, STF I antikoerper, TRF1 antikoerper, sTF1 antikoerper, sTf antikoerper, tf1 antikoerper, transferrin antikoerper, serotransferrin antikoerper, transferrin (ovotransferrin) antikoerper, transferrin L homeolog antikoerper, melanotransferrin antikoerper, transferrin-a antikoerper, Transferrin 1 antikoerper, thyrotropin releasing hormone antikoerper, interleukin 5 antikoerper, TF antikoerper, LOC477072 antikoerper, tf antikoerper, Tf antikoerper, LOC100144362 antikoerper, tf.L antikoerper, LOC5575625 antikoerper, Trf antikoerper, tfa antikoerper, Tsf1 antikoerper, TRH antikoerper, IL5 antikoerper, LOC101085148 antikoerper, LOC100726872 antikoerper, trf antikoerper

Hintergrund: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly.

UniProt: P02787

Pathways: Transition Metal Ion Homeostasis