Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

Transferrin Antikörper (N-Term)

TF Reaktivität: Human, Ratte, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN3043419
  • Target Alle Transferrin (TF) Antikörper anzeigen
    Transferrin (TF)
    Bindungsspezifität
    • 7
    • 7
    • 7
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 20-49, N-Term
    Reaktivität
    • 136
    • 38
    • 37
    • 37
    • 14
    • 12
    • 8
    • 8
    • 7
    • 6
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    Human, Ratte, Maus
    Wirt
    • 154
    • 60
    • 22
    • 14
    • 4
    Kaninchen
    Klonalität
    • 191
    • 59
    • 1
    Polyklonal
    Konjugat
    • 135
    • 36
    • 35
    • 13
    • 7
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Dieser Transferrin Antikörper ist unkonjugiert
    Applikation
    • 159
    • 93
    • 69
    • 47
    • 45
    • 29
    • 28
    • 24
    • 24
    • 20
    • 17
    • 16
    • 13
    • 12
    • 11
    • 9
    • 8
    • 7
    • 6
    • 6
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Verwendungszweck
    Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequenz
    VPDKTVRWCA VSEHEATKCQ SFRDHMKSVI
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: transferrin
    Protein Name: Serotransferrin
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.
    Isotyp
    IgG
    Top Product
    Discover our top product TF Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handhabung
    Avoid repeated freezing and thawing.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Da, Zhuo, Qian: "MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10625-34, (2016) (PubMed).

    Wang, Hu, Tang, Wang, Sun, Chen, Yin, Xue, Sun: "Effect Comparison of Both Iron Chelators on Outcomes, Iron Deposit, and Iron Transporters After Intracerebral Hemorrhage in Rats." in: Molecular neurobiology, (2015) (PubMed).

    Liang, Zhang, Zhao, Li, Yang, Liang, Ceng: "A study of the ultrasound-targeted microbubble destruction based triplex-forming oligodexinucleotide delivery system to inhibit tissue factor expression." in: Molecular medicine reports, Vol. 11, Issue 2, pp. 903-9, (2014) (PubMed).

    Chen, Li, Jiang, Zhang, Zhang, Jiang, He, Li: "Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma." in: Oncology reports, Vol. 32, Issue 2, pp. 755-63, (2014) (PubMed).

    Zhu, Lv, Chen, Wang, Zhong: "Protective effect and mechanism of sodium tanshinone II A sulfonate on microcirculatory disturbance of small intestine in rats with sepsis." in: Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban, Vol. 31, Issue 4, pp. 441-5, (2011) (PubMed).

    Chen, Luo, Tan, Wei, Wu, Zheng, Zhang, Xu: "Immunolocalisation of tissue factor in esophageal cancer is correlated with intratumoral angiogenesis and prognosis of the patient." in: Acta histochemica, Vol. 112, Issue 3, pp. 233-9, (2010) (PubMed).

  • Target
    Transferrin (TF)
    Andere Bezeichnung
    Transferrin (TF Produkte)
    Synonyme
    ltf antikoerper, pro1557 antikoerper, pro2086 antikoerper, mgc107777 antikoerper, LOC692564 antikoerper, TF antikoerper, LOC100144362 antikoerper, tf antikoerper, LTF antikoerper, TFEW antikoerper, conalbumin antikoerper, tf-b antikoerper, MGC64306 antikoerper, PRO1557 antikoerper, PRO2086 antikoerper, TFQTL1 antikoerper, AI266983 antikoerper, Cd176 antikoerper, HP antikoerper, Tf antikoerper, Tfn antikoerper, hpx antikoerper, Trf antikoerper, cb285 antikoerper, gavi antikoerper, id:ibd3238 antikoerper, id:ibd3525 antikoerper, sb:cb285 antikoerper, wu:fb57g06 antikoerper, wu:fb62h02 antikoerper, wu:fb63h10 antikoerper, wu:fb64h10 antikoerper, zgc:112154 antikoerper, 143958_at antikoerper, CG6186 antikoerper, Dmel\\CG6186 antikoerper, TSF1 antikoerper, anon-EST:Posey265 antikoerper, tsf1 antikoerper, Pro-TRH antikoerper, IL-5 antikoerper, STF I antikoerper, TRF1 antikoerper, sTF1 antikoerper, sTf antikoerper, tf1 antikoerper, transferrin antikoerper, serotransferrin antikoerper, transferrin (ovotransferrin) antikoerper, transferrin L homeolog antikoerper, melanotransferrin antikoerper, transferrin-a antikoerper, Transferrin 1 antikoerper, thyrotropin releasing hormone antikoerper, interleukin 5 antikoerper, TF antikoerper, LOC477072 antikoerper, tf antikoerper, Tf antikoerper, LOC100144362 antikoerper, tf.L antikoerper, LOC5575625 antikoerper, Trf antikoerper, tfa antikoerper, Tsf1 antikoerper, TRH antikoerper, IL5 antikoerper, LOC101085148 antikoerper, LOC100726872 antikoerper, trf antikoerper
    Hintergrund
    Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1 % (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M-1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

    Synonyms: Apotransferrin antibody|Beta 1 metal binding globulin antibody|Beta-1 metal-binding globulin antibody|DKFZp781D0156 antibody|PRO1400 antibody|PRO1557 antibody|PRO2086 antibody|Serotransferrin antibody|Serotransferrin precursor antibody|Siderophilin antibody|TF antibody|TFQTL1 antibody|Transferin antibody|Transferrin antibody
    Gen-ID
    7018
    UniProt
    P02787
    Pathways
    Transition Metal Ion Homeostasis
Sie sind hier:
Kundenservice