SMURF2 Antikörper

Produktnummer ABIN4952623

Produktdetails anti-SMURF2 Antikörper

Target: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMURF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ of human SMURF2 were used as the immunogen for the SMURF2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SMURF2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SMURF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SMURF2

Target: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Andere Bezeichnung: SMURF2 (SMURF2 Produkte)

Synonyme: SMURF2 antikoerper, 2810411E22Rik antikoerper, AI558114 antikoerper, AI649275 antikoerper, RGD1310067 antikoerper, wu:fb82a11 antikoerper, wu:fc41c02 antikoerper, SMAD specific E3 ubiquitin protein ligase 2 antikoerper, SMAD specific E3 ubiquitin protein ligase 2 S homeolog antikoerper, SMURF2 antikoerper, smurf2 antikoerper, Smurf2 antikoerper, smurf2.S antikoerper

Hintergrund: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression

UniProt: Q9HAU4