Otoferlin Antikörper

Produktnummer ABIN4952006

Produktdetails anti-Otoferlin Antikörper

Target: Otoferlin (OTOF)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Otoferlin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ of human OTOF were used as the immunogen for the Otoferlin antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Otoferlin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Otoferlin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Otoferlin

Target: Otoferlin (OTOF)

Andere Bezeichnung: Otoferlin (OTOF Produkte)

Synonyme: OTOF antikoerper, Otof antikoerper, AUNB1 antikoerper, DFNB6 antikoerper, DFNB9 antikoerper, FER1L2 antikoerper, NSRD9 antikoerper, fj34b10 antikoerper, si:dkey-181f18.3 antikoerper, wu:fj34b10 antikoerper, otoferlin antikoerper, putative otoferlin antikoerper, otoferlin a antikoerper, OTOF antikoerper, LOC5565414 antikoerper, CpipJ_CPIJ002471 antikoerper, CpipJ_CPIJ010863 antikoerper, Smp_163750 antikoerper, otof antikoerper, Otof antikoerper, otofa antikoerper

Hintergrund: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

UniProt: Q9HC10

Pathways: Sensory Perception of Sound, Synaptic Vesicle Exocytosis