Otoferlin Antikörper (C-Term)

Produktnummer ABIN3042499

Produktdetails anti-Otoferlin Antikörper

Target: Otoferlin (OTOF)

Bindungsspezifität: AA 1831-1863, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Otoferlin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: QIWDADHFSA DDFLGAIELD LNRFPRGAKT AKQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: otoferlin
Protein Name: Otoferlin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Otoferlin

Target: Otoferlin (OTOF)

Andere Bezeichnung: OTOF (OTOF Produkte)

Synonyme: OTOF antikoerper, Otof antikoerper, AUNB1 antikoerper, DFNB6 antikoerper, DFNB9 antikoerper, FER1L2 antikoerper, NSRD9 antikoerper, fj34b10 antikoerper, si:dkey-181f18.3 antikoerper, wu:fj34b10 antikoerper, otoferlin antikoerper, putative otoferlin antikoerper, otoferlin a antikoerper, OTOF antikoerper, LOC5565414 antikoerper, CpipJ_CPIJ002471 antikoerper, CpipJ_CPIJ010863 antikoerper, Smp_163750 antikoerper, otof antikoerper, Otof antikoerper, otofa antikoerper

Hintergrund: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

Synonyms: AUNB1 antibody|Deafness, autosomal recessive 9 antibody|DFNB6 antibody|DFNB9 antibody|Fer 1 like protein 2 antibody|Fer-1-like protein 2 antibody|FER1L2 antibody|NSRD9 antibody|Otof antibody|OTOF_HUMAN antibody|Otoferlin antibody

Gen-ID: 9381

Pathways: Sensory Perception of Sound, Synaptic Vesicle Exocytosis