MCM8 Antikörper

Produktnummer ABIN4951692

Produktdetails anti-MCM8 Antikörper

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM of human MCM8 were used as the immunogen for the MCM8 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MCM8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MCM8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MCM8

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Andere Bezeichnung: MCM8 (MCM8 Produkte)

Synonyme: C20orf154 antikoerper, dJ967N21.5 antikoerper, 5730432L01Rik antikoerper, minichromosome maintenance 8 homologous recombination repair factor antikoerper, minichromosome maintenance 8 homologous recombination repair factor L homeolog antikoerper, MCM8 antikoerper, Mcm8 antikoerper, mcm8.L antikoerper

Hintergrund: DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

UniProt: Q9UJA3

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA