LIFR Antikörper

Produktnummer ABIN4951612

Produktdetails anti-LIFR Antikörper

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIFR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the LIFR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the LIFR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu LIFR

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Andere Bezeichnung: LIF Receptor / LIFR (LIFR Produkte)

Synonyme: A230075M04Rik antikoerper, AW061234 antikoerper, LIF antikoerper, CD118 antikoerper, LIF-R antikoerper, SJS2 antikoerper, STWS antikoerper, SWS antikoerper, leukemia inhibitory factor receptor antikoerper, LIF receptor alpha antikoerper, leukemia inhibitory factor receptor alpha antikoerper, Lifr antikoerper, LOC397451 antikoerper, LIFR antikoerper

Hintergrund: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

UniProt: P42702

Pathways: JAK-STAT Signalweg, Growth Factor Binding