LCAT Antikörper
-
- Target Alle LCAT Antikörper anzeigen
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LCAT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product LCAT Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the LCAT antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the LCAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
- Andere Bezeichnung
- LCAT (LCAT Produkte)
- Synonyme
- AI046659 antikoerper, D8Wsu61e antikoerper, MGC82035 antikoerper, lcat antikoerper, MGC88964 antikoerper, LCAT antikoerper, lecithin-cholesterol acyltransferase antikoerper, lecithin cholesterol acyltransferase antikoerper, lecithin-cholesterol acyltransferase L homeolog antikoerper, solute carrier family 12 member 4 antikoerper, fragile site, aphidicolin type, common, fra(13)(q13.2) antikoerper, LCAT antikoerper, Lcat antikoerper, lcat.L antikoerper, lcat antikoerper, SLC12A4 antikoerper, FRA13A antikoerper
- Hintergrund
- LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
- UniProt
- P16301
- Pathways
- Lipid Metabolism
-