HSP90AB1 Antikörper

Produktnummer ABIN4951373

Produktdetails anti-HSP90AB1 Antikörper

Target: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSP90AB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HSP90 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HSP90 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HSP90AB1

Target: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Andere Bezeichnung: HSP90 beta / HSP90AB1 (HSP90AB1 Produkte)

Synonyme: D6S182 antikoerper, HSP84 antikoerper, HSP90B antikoerper, HSPC2 antikoerper, HSPCB antikoerper, GRP94 antikoerper, TRA1 antikoerper, hsp90b antikoerper, 90kDa antikoerper, AL022974 antikoerper, C81438 antikoerper, Hsp84 antikoerper, Hsp84-1 antikoerper, Hsp90 antikoerper, Hspcb antikoerper, Hsp70 antikoerper, Hsp70-1 antikoerper, Hsp70.1 antikoerper, hsp68 antikoerper, HSP90-BETA antikoerper, hsp90beta antikoerper, wu:fa29f01 antikoerper, wu:fa91e11 antikoerper, wu:fd59e11 antikoerper, wu:gcd22h07 antikoerper, HSP90 antikoerper, heat shock protein 90 alpha family class B member 1 antikoerper, heat shock protein 90 beta family member 1 antikoerper, Heat Shock Protein 90, endoplasmic reticulum antikoerper, heat shock protein 90B antikoerper, heat shock protein 90 alpha (cytosolic), class B member 1 antikoerper, heat shock protein 1B antikoerper, heat shock protein 90kDa alpha family class B member 1 S homeolog antikoerper, heat shock protein 90, alpha (cytosolic), class B member 1 antikoerper, HSP90AB1 antikoerper, HSP90B1 antikoerper, HSP90B antikoerper, hsp90ab1 antikoerper, Hsp90ab1 antikoerper, Hspa1b antikoerper, hsp90ab1.S antikoerper

Hintergrund: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

UniProt: P08238

Pathways: Regulation of Cell Size