HPSE Antikörper

Produktnummer ABIN4951290

Produktdetails anti-HPSE Antikörper

Target: HPSE (Heparanase (HPSE))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HPSE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HPSE

Target: HPSE (Heparanase (HPSE))

Andere Bezeichnung: Heparanase 1 (HPSE Produkte)

Synonyme: im:7144134 antikoerper, hpa antikoerper, hpa1 antikoerper, hpr1 antikoerper, hpse1 antikoerper, hse1 antikoerper, HPSE antikoerper, HPA antikoerper, HPA1 antikoerper, HPR1 antikoerper, HPSE1 antikoerper, HSE1 antikoerper, Hpa antikoerper, Hpr1 antikoerper, Hep antikoerper, heparanase antikoerper, HPSE antikoerper, hpse antikoerper, Hpse antikoerper

Hintergrund: Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

UniProt: Q9Y251

Pathways: Glycosaminoglycan Metabolic Process