HPSE Antikörper
-
- Target Alle HPSE Antikörper anzeigen
- HPSE (Heparanase (HPSE))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HPSE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product HPSE Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- HPSE (Heparanase (HPSE))
- Andere Bezeichnung
- Heparanase 1 (HPSE Produkte)
- Synonyme
- im:7144134 antikoerper, hpa antikoerper, hpa1 antikoerper, hpr1 antikoerper, hpse1 antikoerper, hse1 antikoerper, HPSE antikoerper, HPA antikoerper, HPA1 antikoerper, HPR1 antikoerper, HPSE1 antikoerper, HSE1 antikoerper, Hpa antikoerper, Hpr1 antikoerper, Hep antikoerper, heparanase antikoerper, HPSE antikoerper, hpse antikoerper, Hpse antikoerper
- Hintergrund
- Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
- UniProt
- Q9Y251
- Pathways
- Glycosaminoglycan Metabolic Process
-