ADRBK2 Antikörper

Produktnummer ABIN4951248

Produktdetails anti-ADRBK2 Antikörper

Target: ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADRBK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the GRK3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the GRK3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ADRBK2

Target: ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))

Andere Bezeichnung: GRK3 / ADRBK2 (ADRBK2 Produkte)

Synonyme: bark2 antikoerper, grk3 antikoerper, 4833444A01Rik antikoerper, AI851927 antikoerper, AW551196 antikoerper, Adrbk-2 antikoerper, Bark-2 antikoerper, GRK3 antikoerper, BARK2 antikoerper, Grk3 antikoerper, si:dz221d18.1 antikoerper, G protein-coupled receptor kinase 3 antikoerper, GRK3 antikoerper, grk3 antikoerper, Grk3 antikoerper

Hintergrund: Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85 % amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95 % similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.

UniProt: P35626

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling