DARPP32 Antikörper

Produktnummer ABIN4950763

Produktdetails anti-DARPP32 Antikörper

Target: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DARPP32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA of human DARPP-32 were used as the immunogen for the DARPP-32 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the DARPP-32 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the DARPP-32 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu DARPP32

Target: DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))

Andere Bezeichnung: DARPP-32 (PPP1R1B Produkte)

Synonyme: darpp32 antikoerper, darpp-32 antikoerper, Darpp-32 antikoerper, Darpp32 antikoerper, DARPP-32 antikoerper, DARPP32 antikoerper, AU040756 antikoerper, protein phosphatase 1 regulatory inhibitor subunit 1B antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 1B antikoerper, protein phosphatase 1 regulatory inhibitor subunit 1B S homeolog antikoerper, ppp1r1b antikoerper, PPP1R1B antikoerper, Ppp1r1b antikoerper, ppp1r1b.S antikoerper

Hintergrund: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9UD71