CPT1B Antikörper

Produktnummer ABIN4950637

Produktdetails anti-CPT1B Antikörper

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPT1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CPT1B antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CPT1B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CPT1B

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Andere Bezeichnung: CPT1B (CPT1B Produkte)

Synonyme: CPT1-M antikoerper, CPT1M antikoerper, CPTI antikoerper, CPTI-M antikoerper, M-CPT1 antikoerper, MCCPT1 antikoerper, MCPT1 antikoerper, CPT-IB antikoerper, M-CPTI antikoerper, CPT1 antikoerper, CPTIB antikoerper, cpt1al antikoerper, zgc:103709 antikoerper, CPT1B antikoerper, MGC147544 antikoerper, Cpt1 antikoerper, Cpt1-m antikoerper, Cpti antikoerper, Cpti-m antikoerper, M-cpti antikoerper, carnitine palmitoyltransferase 1B antikoerper, carnitine palmitoyltransferase 1B (muscle) antikoerper, carnitine palmitoyltransferase 1B L homeolog antikoerper, carnitine palmitoyltransferase 1b, muscle antikoerper, CPT1B antikoerper, Cpt1b antikoerper, cpt1b antikoerper, cpt1b.L antikoerper

Hintergrund: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

UniProt: Q92523

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process