B3GNT8 Antikörper

Produktnummer ABIN4950282

Produktdetails anti-B3GNT8 Antikörper

Target: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GNT8 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the B3GNT8 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the B3GNT8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu B3GNT8

Target: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Andere Bezeichnung: B3GNT8 (B3GNT8 Produkte)

Synonyme: B3GALT7 antikoerper, BGALT15 antikoerper, beta3Gn-T8 antikoerper, B3galt7 antikoerper, B7galt7 antikoerper, BC025206 antikoerper, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 antikoerper, B3GNT8 antikoerper, B3gnt8 antikoerper

Hintergrund: B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.

UniProt: Q7Z7M8