B3GNT8 Antikörper (C-Term)

Produktnummer ABIN3043797

Produktdetails anti-B3GNT8 Antikörper

Target: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Bindungsspezifität: AA 360-397, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8(B3GNT8) detection. Tested with WB, IHC-P in Human.

Sequenz: ADRTADHCAF RNLLLVRPLG PQASIRLWKQ LQDPRLQC

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8(B3GNT8) detection. Tested with WB, IHC-P in Human.
Gene Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
Protein Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu B3GNT8

Target: B3GNT8 (UDP-GlcNAc:betaGal beta-1,3-N-Acetylglucosaminyltransferase 8 (B3GNT8))

Andere Bezeichnung: B3GNT8 (B3GNT8 Produkte)

Synonyme: B3GALT7 antikoerper, BGALT15 antikoerper, beta3Gn-T8 antikoerper, B3galt7 antikoerper, B7galt7 antikoerper, BC025206 antikoerper, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 antikoerper, B3GNT8 antikoerper, B3gnt8 antikoerper

Hintergrund: B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.

Synonyms: 3-Gn-T8 antibody|3-N-acetylglucosaminyltransferase 8 antibody|B3GN8_HUMAN antibody|B3gnt8 antibody|Beta-1 antibody|Beta3Gn-T8 antibody|BGnT-8 antibody|UDP-GlcNAc:betaGal beta-1 antibody

Gen-ID: 374907

UniProt: Q7Z7M8