ARID1A Antikörper

Produktnummer ABIN4950208

Produktdetails anti-ARID1A Antikörper

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARID1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ARID1A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ARID1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ARID1A

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Andere Bezeichnung: ARID1A (ARID1A Produkte)

Synonyme: B120 antikoerper, BAF250 antikoerper, BAF250a antikoerper, BM029 antikoerper, C1orf4 antikoerper, ELD antikoerper, MRD14 antikoerper, OSA1 antikoerper, P270 antikoerper, SMARCF1 antikoerper, hELD antikoerper, hOSA1 antikoerper, 1110030E03Rik antikoerper, Osa1 antikoerper, Smarcf1 antikoerper, ARID1A antikoerper, wu:fb79b07 antikoerper, wu:fb95g08 antikoerper, zgc:171438 antikoerper, AT-rich interaction domain 1A antikoerper, AT rich interactive domain 1A (SWI-like) antikoerper, AT rich interactive domain 1Aa (SWI-like) antikoerper, ARID1A antikoerper, Arid1a antikoerper, arid1a antikoerper, arid1aa antikoerper

Hintergrund: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

UniProt: O14497

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Tube Formation