CYP3A4 Antikörper (Middle Region)

Produktnummer ABIN4886557

Produktdetails anti-CYP3A4 Antikörper

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Bindungsspezifität: AA 237-277, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP3A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.

Sequenz: NICVFPREVT NFLRKSVKRM KESRLEDTQK HRVDFLQLMI D

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.
Gene Name: cytochrome P450 family 3 subfamily A member 4
Protein Name: Cytochrome P450 3A4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CYP3A4

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Andere Bezeichnung: CYP3A4 (CYP3A4 Produkte)

Synonyme: CP33 antikoerper, CP34 antikoerper, CYP3A antikoerper, CYP3A3 antikoerper, CYPIIIA3 antikoerper, CYPIIIA4 antikoerper, HLP antikoerper, NF-25 antikoerper, P450C3 antikoerper, P450PCN1 antikoerper, MGC108372 antikoerper, CYP3A80 antikoerper, CYP3A4 antikoerper, CYP3A21 antikoerper, CYPIIIA21 antikoerper, CYP3A12 antikoerper, cytochrome P450 family 3 subfamily A member 4 antikoerper, cytochrome P450 family 3 subfamily A member 43 antikoerper, cytochrome P450 3A4 antikoerper, cytochrome P450, subfamily IIIA, polypeptide 4 antikoerper, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antikoerper, cytochrome P450, family 3, subfamily A, polypeptide 4 antikoerper, CYP3A4 antikoerper, CYP3A43 antikoerper, PTRG_01782 antikoerper, PTRG_06060 antikoerper, cyp3a4 antikoerper

Hintergrund: Cytochrome P450 3A4 (abbreviated CYP3A4), is an important enzyme in the body, mainly found in the liver and in the intestine. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist, however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms: CP33 | CP34 | CYP3 | CYP3A | CYP3A3 | CYP3A4 | CYPIIIA3 | CYPIIIA4 | HLP | NF 25 | NF25 | Nifedipine oxidase | P450 PCN1 | P450C3 | P450PCN1 | P08684

Gen-ID: 1576

UniProt: P08684

Pathways: Steroid Hormone Biosynthesis