CYP17A1 Antikörper (C-Term)

Produktnummer ABIN4886555

Produktdetails anti-CYP17A1 Antikörper

Target: CYP17A1 (Cytochrome P450, Family 17, Subfamily A, Polypeptide 1 (CYP17A1))

Bindungsspezifität: AA 383-419, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP17A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1) detection. Tested with WB, IHC-P in Human.

Sequenz: EFAVDKGTEV IINLWALHHN EKEWHQPDQF MPERFLN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Steroid 17-alpha-hydroxylase/17,20 lyase(CYP17A1) detection. Tested with WB, IHC-P in Human.
Gene Name: cytochrome P450 family 17 subfamily A member 1
Protein Name: Steroid 17-alpha-hydroxylase/17,20 lyase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CYP17A1

Target: CYP17A1 (Cytochrome P450, Family 17, Subfamily A, Polypeptide 1 (CYP17A1))

Andere Bezeichnung: CYP17A1 (CYP17A1 Produkte)

Synonyme: cyp17 antikoerper, CYPXVII antikoerper, P450c17 antikoerper, cyp17a1 antikoerper, P450-C17 antikoerper, wu:fi13g04 antikoerper, wu:fi17b11 antikoerper, wu:fi31c08 antikoerper, zgc:136516 antikoerper, zgc:66494 antikoerper, P45017A1 antikoerper, CYP17 antikoerper, CPT7 antikoerper, P450C17 antikoerper, S17AH antikoerper, Cyp17 antikoerper, p450c17 antikoerper, cytochrome P450 17A1 antikoerper, cytochrome P450, family 17, subfamily A, polypeptide 1 antikoerper, steroidogenic cytochrome P450 17-hydroxylase/lyase antikoerper, cytochrome P450 family 17 subfamily A member 1 L homeolog antikoerper, cytochrome P450 family 17 subfamily A member 1 antikoerper, cytochrome P-450 17 alpha-hydroxylase/C17,20-lyase antikoerper, cytochrome P450, family 17, subfamily a, polypeptide 1 antikoerper, cytochrome P450c17 antikoerper, CpipJ_CPIJ010537 antikoerper, CpipJ_CPIJ010543 antikoerper, PTRG_02047 antikoerper, cyp17a1 antikoerper, cyp17 antikoerper, cyp17a1.L antikoerper, CYP17A1 antikoerper, Cyp17a1 antikoerper

Hintergrund: Cytochrome P450 17A1, also called steroid 17α-monooxygenase, is an enzyme of the hydroxylase type that in humans is encoded by the CYP17A1 gene on chromosome 10. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.

Synonyms: 20 lyase | CPT7 | CYP17 | CYP17A1 | CYPXVII | P450 C17 | P450c17 | S17AH | P05093

Gen-ID: 1586

UniProt: P05093

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, C21-Steroid Hormone Metabolic Process, Cellular Response to Molecule of Bacterial Origin