AGO2 Antikörper (N-Term)
-
- Target Alle AGO2 Antikörper anzeigen
- AGO2 (Argonaute 2 (AGO2))
-
Bindungsspezifität
- AA 129-169, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AGO2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Protein argonaute-2(AGO2) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- KVSIKWVSCV SLQALHDALS GRLPSVPFET IQALDVVMRH L
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Protein argonaute-2(AGO2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: argonaute 2, RISC catalytic component
Protein Name: Protein argonaute-2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product AGO2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AGO2 (Argonaute 2 (AGO2))
- Andere Bezeichnung
- AGO2 (AGO2 Produkte)
- Synonyme
- EIF2C2 antikoerper, T19E23.7 antikoerper, T19E23_7 antikoerper, argonaute 2 antikoerper, Q10 antikoerper, Eif2c2 antikoerper, Argonaute2 antikoerper, eif2c1 antikoerper, eif2c2 antikoerper, 1110029L17Rik antikoerper, 2310051F07Rik antikoerper, AI225898 antikoerper, AL022874 antikoerper, AW546247 antikoerper, ENSMUSG00000072493 antikoerper, Gerp95 antikoerper, Gm10365 antikoerper, mKIAA4215 antikoerper, AGO2 antikoerper, AG02 antikoerper, AGO 2 antikoerper, Ago-2 antikoerper, Ago2 antikoerper, CG13452 antikoerper, CG7439 antikoerper, Dm Ago2 antikoerper, Dmel\\CG7439 antikoerper, ago antikoerper, ago-2 antikoerper, ago2 antikoerper, dAGO2 antikoerper, dAgo2 antikoerper, eIF2C2 antikoerper, argonaute 2, RISC catalytic component antikoerper, Argonaute family protein antikoerper, argonaute 2, RISC catalytic component L homeolog antikoerper, argonaute RISC catalytic subunit 2 antikoerper, argonaute RISC catalytic component 2 antikoerper, Argonaute 2 antikoerper, AGO2 antikoerper, Ago2 antikoerper, ago2.L antikoerper, ago2 antikoerper
- Hintergrund
-
Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: Ago 2 | Ago2 | Argonaute2 | Argonaute-2 | Argonaute 2 | dAgo2 | eIF 2C 2 | eIF-2C 2 | eIF2C 2 | Eif2c2 | hAgo2 | PAZ Piwi domain protein | PPD | Q10 | Slicer protein | Q9UKV8 - Gen-ID
- 27161
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Ribonucleoprotein Complex Subunit Organization
-