SMURF2 Antikörper (Middle Region)

Produktnummer ABIN3044498

Produktdetails anti-SMURF2 Antikörper

Target: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Bindungsspezifität: AA 317-351, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMURF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human.

Sequenz: DHNNRTTQFT DPRLSANLHL VLNRQNQLKD QQQQQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human.
Gene Name: SMAD specific E3 ubiquitin protein ligase 2
Protein Name: E3 ubiquitin-protein ligase SMURF2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SMURF2

Target: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Andere Bezeichnung: SMURF2 (SMURF2 Produkte)

Synonyme: SMURF2 antikoerper, 2810411E22Rik antikoerper, AI558114 antikoerper, AI649275 antikoerper, RGD1310067 antikoerper, wu:fb82a11 antikoerper, wu:fc41c02 antikoerper, SMAD specific E3 ubiquitin protein ligase 2 antikoerper, SMAD specific E3 ubiquitin protein ligase 2 S homeolog antikoerper, SMURF2 antikoerper, smurf2 antikoerper, Smurf2 antikoerper, smurf2.S antikoerper

Hintergrund: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression

Synonyms: E3 ubiquitin-protein ligase SMURF2 antibody|EC 6.3.2. antibody|hSMURF2 antibody|MGC138150 antibody|Smad specific E3 ubiquitin ligase 2 antibody|SMAD specific E3 ubiquitin protein ligase 2 antibody|SMAD ubiquitination regulatory factor 2 antibody|SMAD-specific E3 ubiquitin-protein ligase 2 antibody|SMUF2_HUMAN antibody|Smurf2 antibody|Ubiquitin protein ligase SMURF2 antibody

Gen-ID: 64750