XRCC6 Antikörper (C-Term)

Produktnummer ABIN3043965

Produktdetails anti-XRCC6 Antikörper

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Bindungsspezifität: AA 464-496, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XRCC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.

Sequenz: AIVEKLRFTY RSDSFENPVL QQHFRNLEAL ALD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.
Gene Name: X-ray repair complementing defective repair in Chinese hamster cells 6
Protein Name: X-ray repair cross-complementing protein 6

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu XRCC6

Target: XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))

Andere Bezeichnung: XRCC6 (XRCC6 Produkte)

Synonyme: CTC75 antikoerper, CTCBF antikoerper, G22P1 antikoerper, KU70 antikoerper, ML8 antikoerper, TLAA antikoerper, 70kDa antikoerper, G22p1 antikoerper, Ku70 antikoerper, Kup70 antikoerper, X-ray repair cross complementing 6 antikoerper, ATP-dependent DNA helicase II, 70 kDa subunit antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog antikoerper, X-ray repair complementing defective repair in Chinese hamster cells 6 antikoerper, XRCC6 antikoerper, Bm1_41430 antikoerper, xrcc6.L antikoerper, Xrcc6 antikoerper

Hintergrund: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.

Synonyms: 5''-deoxyribose-5-phosphate lyase Ku70 antibody|5''-dRP lyase Ku70 antibody|70 kDa subunit of Ku antigen antibody|ATP dependent DNA helicase 2 subunit 1 antibody|ATP dependent DNA helicase II 70 kDa subunit antibody|ATP-dependent DNA helicase 2 subunit 1 antibody|ATP-dependent DNA helicase II 70 kDa subunit antibody|CTC box binding factor 75 kDa subunit antibody|CTC box-binding factor 75 kDa subunit antibody|CTC75 antibody|CTCBF antibody|DNA repair protein XRCC6 antibody|G22P1 antibody|Ku 70 antibody|Ku autoantigen 70 kDa antibody| Ku autoantigen p70 subunit antibody|Ku autoantigen, 70 kDa antibody|Ku p70 antibody|Ku70 antibody|Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa antibody|Kup70 antibody|Lupus Ku autoantigen protein p70 antibody|ML8 antibody|Thyroid autoantigen 70kD (Ku antigen) antibody|Thyroid autoantigen antibody| Thyroid lupus autoantigen antibody|Thyroid lupus autoantigen p70 antibody|Thyroid-lupus autoantigen antibody|TLAA antibody|X ray repair complementing defective repair in Chinese hamster cells 6 antibody|X-ray repair complementing defective repair in Chinese hamster cells 6 antibody|X-ray repair cross-complementing protein 6 antibody|XRCC 6 antibody|XRCC6 antibody|XRCC6_HUMAN antibody

Gen-ID: 2547

UniProt: P12956

Pathways: DNA Reparatur