PTPRF Antikörper (Middle Region)

Produktnummer ABIN3043915

Produktdetails anti-PTPRF Antikörper

Target: PTPRF (Protein Tyrosine Phosphatase Receptor Type F (PTPRF))

Bindungsspezifität: AA 1167-1203, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPRF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase F(PTPRF) detection. Tested with WB, IHC-P in Human.

Sequenz: EQGGEEQRRR RRQAERLKPY VAAQLDVLPE TFTLGDK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase F(PTPRF) detection. Tested with WB, IHC-P in Human.
Gene Name: protein tyrosine phosphatase, receptor type, F
Protein Name: Receptor-type tyrosine-protein phosphatase F

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PTPRF

Target: PTPRF (Protein Tyrosine Phosphatase Receptor Type F (PTPRF))

Andere Bezeichnung: PTPRF (PTPRF Produkte)

Synonyme: LAR antikoerper, AA591035 antikoerper, LARS antikoerper, RPTP-LAR antikoerper, LARFN5C antikoerper, zf-LAR antikoerper, protein tyrosine phosphatase, receptor type F antikoerper, protein tyrosine phosphatase, receptor type, F antikoerper, protein tyrosine phosphatase, receptor type, f, a antikoerper, PTPRF antikoerper, Ptprf antikoerper, ptprfa antikoerper

Hintergrund: Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.

Synonyms: FLJ43335 antibody|FLJ45062 antibody|FLJ45567 antibody|LAR antibody|LAR protein antibody|LARFN5C antibody|LARS antibody|LCA homolog antibody|Leukocyte antigen related (LAR) PTP receptor antibody|Leukocyte antigen related antibody|Leukocyte antigen related PTP receptor antibody|Leukocyte antigen related tyrosine phosphatase antibody|Leukocyte common antigen related antibody|Protein Tyrosine Phosphatase Receptor Type F antibody|Protein tyrosine phosphatase receptor type F polypeptide antibody|Ptprf antibody|PTPRF protein antibody|PTPRF_HUMAN antibody|Receptor linked protein tyrosine phosphatase LAR antibody|Receptor type tyrosine protein phosphatase F antibody|Receptor type tyrosine protein phosphatase F precursor antibody|Receptor-type tyrosine-protein phosphatase F antibody

Gen-ID: 5792

UniProt: P10586

Pathways: EGFR Signaling Pathway