Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

GRP78 Antikörper (C-Term)

HSPA5 Reaktivität: Human, Ratte, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN3043851
  • Target Alle GRP78 (HSPA5) Antikörper anzeigen
    GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
    Bindungsspezifität
    • 26
    • 16
    • 13
    • 8
    • 7
    • 6
    • 6
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 592-624, C-Term
    Reaktivität
    • 187
    • 125
    • 108
    • 39
    • 38
    • 36
    • 34
    • 32
    • 31
    • 20
    • 17
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Ratte, Maus
    Wirt
    • 131
    • 91
    • 9
    • 3
    • 1
    • 1
    Kaninchen
    Klonalität
    • 134
    • 103
    Polyklonal
    Konjugat
    • 102
    • 21
    • 17
    • 14
    • 13
    • 12
    • 9
    • 8
    • 8
    • 8
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Dieser GRP78 Antikörper ist unkonjugiert
    Applikation
    • 222
    • 104
    • 89
    • 85
    • 76
    • 34
    • 31
    • 28
    • 26
    • 21
    • 13
    • 7
    • 6
    • 3
    • 3
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Verwendungszweck
    Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequenz
    ETMEKAVEEK IEWLESHQDA DIEDFKAKKK ELE
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa)
    Protein Name: 78 kDa glucose-regulated protein
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.
    Isotyp
    IgG
    Top Product
    Discover our top product HSPA5 Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handhabung
    Avoid repeated freezing and thawing.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Wang, Wang, Huang, Yang, Zhao, Wei, Zhao: "Erratum to: Ibutilide protects against cardiomyocytes injury via inhibiting endoplasmic reticulum and mitochondrial stress pathways." in: Heart and vessels, Vol. 32, Issue 2, pp. 216, (2016) (PubMed).

    Wu, Dong, Li: "Effects of miRNA-455 on cardiac hypertrophy induced by pressure overload." in: International journal of molecular medicine, Vol. 35, Issue 4, pp. 893-900, (2015) (PubMed).

    Li, Zhao, Xing, Sun: "Ulinastatin suppresses endoplasmic reticulum stress and apoptosis in the hippocampus of rats with acute paraquat poisoning." in: Neural regeneration research, Vol. 10, Issue 3, pp. 467-72, (2015) (PubMed).

    Ding, Zou, Li, Tian, Abdelalim, Du, She, Wang, Tan, Wang, Chen, Lv, Chang: "Study of histopathological and molecular changes of rat kidney under simulated weightlessness and resistance training protective effect." in: PLoS ONE, Vol. 6, Issue 5, pp. e20008, (2011) (PubMed).

  • Target
    GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
    Andere Bezeichnung
    HSPA5 (HSPA5 Produkte)
    Synonyme
    GRP78 antikoerper, BiP antikoerper, GRP-78 antikoerper, grp78 antikoerper, hspa5a antikoerper, BIP antikoerper, MIF2 antikoerper, AL022860 antikoerper, AU019543 antikoerper, Bip antikoerper, D2Wsu141e antikoerper, D2Wsu17e antikoerper, Grp78 antikoerper, Hsce70 antikoerper, SEZ-7 antikoerper, Sez7 antikoerper, baffled antikoerper, mBiP antikoerper, cb865 antikoerper, fb60h09 antikoerper, fi36d04 antikoerper, wu:fb60h09 antikoerper, wu:fi36d04 antikoerper, zgc:55994 antikoerper, zgc:77606 antikoerper, 78 kDa glucose-regulated protein antikoerper, heat shock protein family A (Hsp70) member 5 antikoerper, BiP/GRP78 antikoerper, glucose-regulated protein 78 antikoerper, putative glucose-regulated protein 78 antikoerper, Hsp70 family ATPase KAR2 antikoerper, heat shock protein family A (Hsp70) member 5 S homeolog antikoerper, heat shock 70 kDa protein 5a antikoerper, heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) antikoerper, heat shock protein 5 antikoerper, heat shock protein family A member 5 antikoerper, CpipJ_CPIJ003550 antikoerper, HSPA5 antikoerper, grp78 antikoerper, LOC100533358 antikoerper, BiP/grp78 antikoerper, Tc00.1047053506585.40 antikoerper, Tb11.02.5450 antikoerper, Tb11.02.5500 antikoerper, LMJF_28_1200 antikoerper, KAR2 antikoerper, LOC100135840 antikoerper, hspa5.S antikoerper, hspa5 antikoerper, Hspa5 antikoerper
    Hintergrund
    HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

    Synonyms: 78 kDa glucose regulated protein antibody|78 kDa glucose-regulated protein antibody| AL022860 antibody|AU019543 antibody|BIP antibody| D2Wsu141e antibody|D2Wsu17e antibody| Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78 antibody|Endoplasmic reticulum lumenal Ca2+ binding protein grp78 antibody|FLJ26106 antibody|Glucose Regulated Protein 78 kDa antibody|GRP 78 antibody|GRP-78 antibody|GRP78 antibody|GRP78_HUMAN antibody|Heat shock 70 kDa protein 5 antibody|Heat Shock 70 kDa Protein 5 antibody|Hsce70 antibody| HSPA 5 antibody|HSPA5 antibody|Immunoglobulin Heavy Chain Binding Protein antibody|Immunoglobulin heavy chain-binding protein antibody|mBiP antibody|MIF2 antibody|Sez7 antibody
    Gen-ID
    3309
    UniProt
    P11021
    Pathways
    Thyroid Hormone Synthesis, ER-Nucleus Signaling
Sie sind hier:
Kundenservice