GRP78 Antikörper (C-Term)
-
- Target Alle GRP78 (HSPA5) Antikörper anzeigen
- GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
-
Bindungsspezifität
- AA 592-624, C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRP78 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- ETMEKAVEEK IEWLESHQDA DIEDFKAKKK ELE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa)
Protein Name: 78 kDa glucose-regulated protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product HSPA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Erratum to: Ibutilide protects against cardiomyocytes injury via inhibiting endoplasmic reticulum and mitochondrial stress pathways." in: Heart and vessels, Vol. 32, Issue 2, pp. 216, (2016) (PubMed).
: "Effects of miRNA-455 on cardiac hypertrophy induced by pressure overload." in: International journal of molecular medicine, Vol. 35, Issue 4, pp. 893-900, (2015) (PubMed).
: "Ulinastatin suppresses endoplasmic reticulum stress and apoptosis in the hippocampus of rats with acute paraquat poisoning." in: Neural regeneration research, Vol. 10, Issue 3, pp. 467-72, (2015) (PubMed).
: "Study of histopathological and molecular changes of rat kidney under simulated weightlessness and resistance training protective effect." in: PLoS ONE, Vol. 6, Issue 5, pp. e20008, (2011) (PubMed).
: "
-
Erratum to: Ibutilide protects against cardiomyocytes injury via inhibiting endoplasmic reticulum and mitochondrial stress pathways." in: Heart and vessels, Vol. 32, Issue 2, pp. 216, (2016) (PubMed).
-
- Target
- GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
- Andere Bezeichnung
- HSPA5 (HSPA5 Produkte)
- Synonyme
- GRP78 antikoerper, BiP antikoerper, GRP-78 antikoerper, grp78 antikoerper, hspa5a antikoerper, BIP antikoerper, MIF2 antikoerper, AL022860 antikoerper, AU019543 antikoerper, Bip antikoerper, D2Wsu141e antikoerper, D2Wsu17e antikoerper, Grp78 antikoerper, Hsce70 antikoerper, SEZ-7 antikoerper, Sez7 antikoerper, baffled antikoerper, mBiP antikoerper, cb865 antikoerper, fb60h09 antikoerper, fi36d04 antikoerper, wu:fb60h09 antikoerper, wu:fi36d04 antikoerper, zgc:55994 antikoerper, zgc:77606 antikoerper, 78 kDa glucose-regulated protein antikoerper, heat shock protein family A (Hsp70) member 5 antikoerper, BiP/GRP78 antikoerper, glucose-regulated protein 78 antikoerper, putative glucose-regulated protein 78 antikoerper, Hsp70 family ATPase KAR2 antikoerper, heat shock protein family A (Hsp70) member 5 S homeolog antikoerper, heat shock 70 kDa protein 5a antikoerper, heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) antikoerper, heat shock protein 5 antikoerper, heat shock protein family A member 5 antikoerper, CpipJ_CPIJ003550 antikoerper, HSPA5 antikoerper, grp78 antikoerper, LOC100533358 antikoerper, BiP/grp78 antikoerper, Tc00.1047053506585.40 antikoerper, Tb11.02.5450 antikoerper, Tb11.02.5500 antikoerper, LMJF_28_1200 antikoerper, KAR2 antikoerper, LOC100135840 antikoerper, hspa5.S antikoerper, hspa5 antikoerper, Hspa5 antikoerper
- Hintergrund
-
HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.
Synonyms: 78 kDa glucose regulated protein antibody|78 kDa glucose-regulated protein antibody| AL022860 antibody|AU019543 antibody|BIP antibody| D2Wsu141e antibody|D2Wsu17e antibody| Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78 antibody|Endoplasmic reticulum lumenal Ca2+ binding protein grp78 antibody|FLJ26106 antibody|Glucose Regulated Protein 78 kDa antibody|GRP 78 antibody|GRP-78 antibody|GRP78 antibody|GRP78_HUMAN antibody|Heat shock 70 kDa protein 5 antibody|Heat Shock 70 kDa Protein 5 antibody|Hsce70 antibody| HSPA 5 antibody|HSPA5 antibody|Immunoglobulin Heavy Chain Binding Protein antibody|Immunoglobulin heavy chain-binding protein antibody|mBiP antibody|MIF2 antibody|Sez7 antibody - Gen-ID
- 3309
- UniProt
- P11021
- Pathways
- Thyroid Hormone Synthesis, ER-Nucleus Signaling
-