Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

HSP90AA1 Antikörper (C-Term)

HSP90AA1 Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN3043848
  • Target Alle HSP90AA1 Antikörper anzeigen
    HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))
    Bindungsspezifität
    • 7
    • 5
    • 4
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 454-488, C-Term
    Reaktivität
    • 70
    • 51
    • 41
    • 14
    • 13
    • 12
    • 12
    • 9
    • 9
    • 7
    • 7
    • 6
    • 5
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Maus, Ratte
    Wirt
    • 50
    • 17
    • 5
    Kaninchen
    Klonalität
    • 49
    • 23
    Polyklonal
    Konjugat
    • 54
    • 8
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser HSP90AA1 Antikörper ist unkonjugiert
    Applikation
    • 62
    • 22
    • 20
    • 15
    • 14
    • 13
    • 9
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Verwendungszweck
    Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequenz
    QNRKKLSELL RYYTSASGDE MVSLKDYCTR MKEN
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: heat shock protein 90 kDa alpha (cytosolic), class A member 1
    Protein Name: Heat shock protein HSP 90-alpha
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
    Isotyp
    IgG
    Top Product
    Discover our top product HSP90AA1 Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handhabung
    Avoid repeated freezing and thawing.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Cheng, Zhao, Wang, Lu, Wang, Wang, Yao: "The effect of 5'-adenylic acid on hepatic proteome of mice radiated by 60Co γ-ray." in: International journal of molecular sciences, Vol. 15, Issue 1, pp. 186-202, (2014) (PubMed).

    Jiang, Wang, Li, Shi, Li, Ma, Li, Luo, Yang, Xu: "Heat shock protein 90-mediated inactivation of nuclear factor-?B switches autophagy to apoptosis through becn1 transcriptional inhibition in selenite-induced NB4 cells." in: Molecular biology of the cell, Vol. 22, Issue 8, pp. 1167-80, (2011) (PubMed).

  • Target
    HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))
    Andere Bezeichnung
    HSP90AA1 (HSP90AA1 Produkte)
    Synonyme
    EL52 antikoerper, HSP86 antikoerper, HSP89A antikoerper, HSP90A antikoerper, HSP90N antikoerper, HSPC1 antikoerper, HSPCA antikoerper, HSPCAL1 antikoerper, HSPCAL4 antikoerper, HSPN antikoerper, Hsp89 antikoerper, Hsp90 antikoerper, LAP2 antikoerper, Hsp86 antikoerper, Hspca antikoerper, htpG antikoerper, 86kDa antikoerper, 89kDa antikoerper, AL024080 antikoerper, AL024147 antikoerper, Hsp86-1 antikoerper, hsp4 antikoerper, HSP90 antikoerper, HSP90AA1 antikoerper, fb17b01 antikoerper, hsp90 antikoerper, hsp90a antikoerper, hsp90a.1 antikoerper, hsp90alpha antikoerper, wu:fb17b01 antikoerper, zgc:86652 antikoerper, Hsp90alpha antikoerper, heat shock protein 90 alpha family class A member 1 antikoerper, heat shock protein 90, alpha (cytosolic), class A member 1 antikoerper, Heat Shock Protein 90, cytosolic antikoerper, heat shock protein 90A antikoerper, molecular chaperone antikoerper, heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 antikoerper, heat shock protein HSP 90-alpha antikoerper, heat shock protein 90kDa alpha (cytosolic), class A member 1 antikoerper, HSP90AA1 antikoerper, Hsp90aa1 antikoerper, HSP90A antikoerper, hsp90A antikoerper, hsp90aa1.1 antikoerper, LOC108698781 antikoerper
    Hintergrund
    Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90- kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85 % amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

    Synonyms: EL52 antibody|epididymis luminal secretory protein 52 antibody|Heat shock 86 kDa antibody|heat shock 90kD protein 1, alpha antibody| Heat shock 90kD protein 1, alpha like 4 antibody|heat shock 90kD protein, alpha-like 4 antibody|Heat shock 90 kDa protein 1 alpha antibody|Heat shock protein 90 kDa alpha (cytosolic) class A member 1 antibody|heat shock protein 90 kDa alpha (cytosolic), class A member 2 antibody|Heat shock protein HSP 90-alpha antibody|HS90A_HUMAN antibody|HSP 86 antibody|HSP 86 antibody|HSP86 antibody|Hsp89 antibody|HSP89A antibody|Hsp90 antibody|HSP90A antibody|HSP90AA1 antibody|HSP90ALPHA antibody|HSP90N antibody|HSPC1 antibody|HSPCA antibody|HSPCAL1 antibody|HSPCAL3 antibody|HSPCAL4 antibody|HSPN antibody|LAP 2 antibody|LAP2 antibody|lipopolysaccharide-associated protein 2 antibody|LPS-associated protein 2 antibody|Renal carcinoma antigen NY REN 38 antibody|Renal carcinoma antigen NY-REN-38 antibody
    Gen-ID
    3320
    UniProt
    P07900
    Pathways
    M Phase, Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
Sie sind hier:
Kundenservice