JNK2 Antikörper (Middle Region)

Produktnummer ABIN3043612

Produktdetails anti-JNK2 Antikörper

Target: JNK2 (MAPK9) (Mitogen-Activated Protein Kinase 9 (MAPK9))

Bindungsspezifität: AA 257-288, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser JNK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.

Sequenz: RNYVENRPKY PGIKFEELFP DWIFPSESER DK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.
Gene Name: mitogen-activated protein kinase 9
Protein Name: Mitogen-activated protein kinase 9

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu JNK2

Target: JNK2 (MAPK9) (Mitogen-Activated Protein Kinase 9 (MAPK9))

Andere Bezeichnung: MAPK9 (MAPK9 Produkte)

Synonyme: MAPK9 antikoerper, JNK-55 antikoerper, JNK2 antikoerper, JNK2A antikoerper, JNK2ALPHA antikoerper, JNK2B antikoerper, JNK2BETA antikoerper, PRKM9 antikoerper, SAPK antikoerper, SAPK1a antikoerper, p54a antikoerper, p54aSAPK antikoerper, AI851083 antikoerper, Prkm9 antikoerper, JNK2-ALPHA1 antikoerper, MAP kinase 9 antikoerper, mitogen-activated protein kinase 9 antikoerper, MAP kinase 9 antikoerper, MAPK9 antikoerper, Mapk9 antikoerper, MPK9 antikoerper

Hintergrund: JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Synonyms: c Jun kinase 2 antibody|C Jun N terminal kinase 2 antibody|c-Jun N-terminal kinase 2 antibody|JNK 55 antibody|JNK-55 antibody|JNK2 alpha antibody|JNK2 antibody|JNK2 beta antibody|JNK2A antibody|JNK2alpha antibody|JNK2B antibody|JNK2BETA antibody|Jun kinase antibody|MAP kinase 9 antibody|MAPK 9 antibody|Mapk9 antibody|Mitogen activated protein kinase 9 antibody|Mitogen-activated protein kinase 9 antibody|MK09_HUMAN antibody|P54a antibody|p54aSAPK antibody|PRKM9 antibody|SAPK alpha antibody|SAPK antibody|SAPK1a antibody|Stress activated protein kinase 1a antibody|Stress-activated protein kinase JNK2 antibody

Gen-ID: 5601

UniProt: P45984

Pathways: MAPK Signalweg, WNT Signalweg, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Endopeptidase Activity, Hepatitis C, Toll-Like Receptors Cascades, BCR Signaling, S100 Proteine