PRKAB1 Antikörper (N-Term)

Produktnummer ABIN3043359

Produktdetails anti-PRKAB1 Antikörper

Target: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Bindungsspezifität: AA 32-68, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKAB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.

Sequenz: DRPKILMDSP EDADLFHSEE IKAPEKEEFL AWQHDLE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.
Gene Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit
Protein Name: 5'-AMP-activated protein kinase subunit beta-1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PRKAB1

Target: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Andere Bezeichnung: PRKAB1 (PRKAB1 Produkte)

Synonyme: AMPK antikoerper, HAMPKb antikoerper, 1300015D22Rik antikoerper, AU021155 antikoerper, E430008F22 antikoerper, MGC82489 antikoerper, prkab1 antikoerper, wu:fk93d05 antikoerper, wu:fw87e09 antikoerper, zgc:56652 antikoerper, zgc:76975 antikoerper, zgc:92228 antikoerper, protein kinase AMP-activated non-catalytic subunit beta 1 antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit, b antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit, a antikoerper, PRKAB1 antikoerper, Prkab1 antikoerper, prkab1.S antikoerper, prkab1 antikoerper, prkab1b antikoerper, prkab1a antikoerper

Hintergrund: 5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Synonyms: 1300015D22Rik antibody|5''-AMP-activated protein kinase subunit beta-1 antibody|AAKB1_HUMAN antibody|AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1 antibody|AMP-activated, noncatalytic, beta-1 antibody|AMPK antibody|AMPK beta 1 chain antibody|AMPK subunit beta-1 antibody|AMPK-BETA-1 antibody|AMPKb antibody|AU021155 antibody|E430008F22 antibody| HAMPKb antibody|MGC17785 antibody|PRKAB1 antibody

Gen-ID: 5564

UniProt: Q9Y478

Pathways: AMPK Signaling, Warburg Effekt