SPARC Antikörper (C-Term)

Produktnummer ABIN3043352

Produktdetails anti-SPARC Antikörper

Target: SPARC (Secreted Protein, Acidic, Cysteine-Rich (Osteonectin) (SPARC))

Bindungsspezifität: AA 268-303, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPARC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for SPARC(SPARC) detection. Tested with WB in Human.

Sequenz: RFFETCDLDN DKYIALDEWA GCFGIKQKDI DKDLVI

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for SPARC(SPARC) detection. Tested with WB in Human.
Gene Name: secreted protein, acidic, cysteine-rich (osteonectin)
Protein Name: SPARC

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SPARC

Target: SPARC (Secreted Protein, Acidic, Cysteine-Rich (Osteonectin) (SPARC))

Andere Bezeichnung: SPARC (SPARC Produkte)

Synonyme: ON antikoerper, AA517111 antikoerper, BM-40 antikoerper, hm:zeh0062 antikoerper, SPARC antikoerper, sparc antikoerper, secreted protein acidic and cysteine rich antikoerper, secreted acidic cysteine rich glycoprotein antikoerper, secreted protein, acidic, cysteine-rich (osteonectin) antikoerper, secreted protein, acidic, cysteine-rich (osteonectin) L homeolog antikoerper, secreted protein, acidic, cysteine-rich (osteonectin) S homeolog antikoerper, SPARC antikoerper, Sparc antikoerper, sparc antikoerper, sparc.L antikoerper, sparc.S antikoerper

Hintergrund: SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of 40 kD. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV). Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found.

Synonyms: AA517111 antibody|Basement membrane protein 40 antibody|Basement-membrane protein 40 antibody|BM 40 antibody|BM-40 antibody|BM40 antibody|Cysteine rich protein antibody| hm:zeh0062 antibody|MGC128090 antibody|ON antibody|Osteonectin antibody|Secreted acidic cystein rich glycoprotein antibody|Secreted protein acidic and rich in cysteine antibody| Secreted protein acidic cysteine rich (osteonectin) antibody|Secreted protein acidic cysteine rich antibody|SPARC antibody|SPRC antibody|SPRC_HUMAN antibody

Gen-ID: 6678

UniProt: P09486

Pathways: Autophagie