Neuroserpin Antikörper (C-Term)

Produktnummer ABIN3043332

Produktdetails anti-Neuroserpin Antikörper

Target: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Bindungsspezifität: AA 272-310, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuroserpin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: KAQLVEEWAN SVKKQKVEVY LPRFTVEQEI DLKDVLKA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1
Protein Name: Neuroserpin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Neuroserpin

Target: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Andere Bezeichnung: SERPINI1 (SERPINI1 Produkte)

Synonyme: PI12 antikoerper, neuroserpin antikoerper, AI837402 antikoerper, Ns antikoerper, PI-12 antikoerper, Spi17 antikoerper, CG9453 antikoerper, Dmel\\CG9453 antikoerper, Serp2 antikoerper, Sp4 antikoerper, Spn4 antikoerper, Spn4A antikoerper, dSerp2 antikoerper, sp4 antikoerper, spn4 antikoerper, raPIT5a antikoerper, SERPINI1 antikoerper, pi12 antikoerper, serpini1l antikoerper, si:ch211-167c22.4 antikoerper, serpin family I member 1 antikoerper, serine (or cysteine) peptidase inhibitor, clade I, member 1 antikoerper, Serpin 42Da antikoerper, serpin peptidase inhibitor, clade I (neuroserpin), member 1 antikoerper, serpin family I member 1 L homeolog antikoerper, SERPINI1 antikoerper, Serpini1 antikoerper, Spn42Da antikoerper, serpini1 antikoerper, serpini1.L antikoerper

Hintergrund: Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Synonyms: DKFZp781N13156 antibody|Neuroserpin antibody|NEUS_HUMAN antibody|Peptidase inhibitor 12 antibody|PI-12 antibody|PI12 antibody|Protease inhibitor 12 antibody|Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1 antibody|Serine or cysteine proteinase inhibitor clade I member 1 antibody|Serpin I1 antibody|Serpin peptidase inhibitor clade I (neuroserpin) member 1 antibody|SERPINI1 antibody

Gen-ID: 5274

UniProt: Q99574

Pathways: Regulation of Hormone Metabolic Process