MCM8 Antikörper (C-Term)

Produktnummer ABIN3042508

Produktdetails anti-MCM8 Antikörper

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Bindungsspezifität: AA 809-840, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCM8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.

Sequenz: IQVADFENFI GSLNDQGYLL KKGPKVYQLQ TM

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for DNA helicase MCM8(MCM8) detection. Tested with WB in Human.
Gene Name: minichromosome maintenance 8 homologous recombination repair factor
Protein Name: DNA helicase MCM8

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MCM8 (809-840aa IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MCM8

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Andere Bezeichnung: MCM8 (MCM8 Produkte)

Synonyme: C20orf154 antikoerper, dJ967N21.5 antikoerper, 5730432L01Rik antikoerper, minichromosome maintenance 8 homologous recombination repair factor antikoerper, minichromosome maintenance 8 homologous recombination repair factor L homeolog antikoerper, MCM8 antikoerper, Mcm8 antikoerper, mcm8.L antikoerper

Hintergrund: DNA replication licensing factor MCM8 is a protein that in humans is encoded by the MCM8 gene. The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. And this protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Synonyms: C20orf154 antibody|dJ967N21.5 antibody|DNA helicase MCM8 antibody|DNA replication licensing factor MCM8 antibody|MCM8 antibody| MCM8_HUMAN antibody|MGC119522 antibody|MGC119523 antibody|MGC12866 antibody|MGC4816 antibody|Minichromosome maintenance 8 antibody| Minichromosome maintenance complex component 8 antibody|REC antibody

Gen-ID: 84515

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA