RUNX1 Antikörper (Middle Region)

Produktnummer ABIN3032499

Produktdetails anti-RUNX1 Antikörper

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUNX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the middle region of human RUNX1 (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN) was used as the immunogen for this RUNX1 antibody (100% homologous in human, mouse and rat).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the RUNX1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the RUNX1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu RUNX1

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Andere Bezeichnung: RUNX1 (AML1) (RUNX1 Produkte)

Synonyme: RUNX1 antikoerper, runx1 antikoerper, AI462102 antikoerper, AML1 antikoerper, Cbfa2 antikoerper, Pebp2a2 antikoerper, Pebpa2b antikoerper, AML1-EVI-1 antikoerper, AMLCR1 antikoerper, CBFA2 antikoerper, EVI-1 antikoerper, PEBP2aB antikoerper, runxa antikoerper, Runx-1 antikoerper, XAML antikoerper, Xaml1 antikoerper, aml antikoerper, aml-1 antikoerper, aml1 antikoerper, aml1-evi-1 antikoerper, amlcr1 antikoerper, cbfa2 antikoerper, evi-1 antikoerper, pebp2ab antikoerper, Aml1 antikoerper, uncharacterized LOC473981 antikoerper, runt-related transcription factor antikoerper, runt related transcription factor 1 antikoerper, runt-related transcription factor 1 antikoerper, runt related transcription factor 1 L homeolog antikoerper, LOC473981 antikoerper, runt antikoerper, Runx1 antikoerper, RUNX1 antikoerper, runx1 antikoerper, runx1.L antikoerper

Hintergrund: Runt-related transcription factor 1, also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called Core binding factor alpha (CBFa). RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFb which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the gene are associated with several types of leukemia including M2 AML. Mutations are implicated in cases of breast cancer.

Gen-ID: 861