PIM1 Antikörper (C-Term)
-
- Target Alle PIM1 Antikörper anzeigen
- PIM1 (Pim-1 Oncogene (PIM1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity
- Immunogen
- An amino acid sequence from the C-terminus of human PIM1 (EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK) was used as the immunogen for this PIM-1 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product PIM1 Primärantikörper
-
anti-Pim-1 Oncogene (PIM1) (AA 122-261) antibody
PIM1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 1-100) antibodyPIM1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1C10 unconjugated
anti-Pim-1 Oncogene (PIM1) antibodyPIM1 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (Internal Region) antibodyPIM1 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 374-404), (C-Term) antibodyPIM1 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB1285-RB1286 unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 1-100) antibodyPIM1 Reaktivität: Human WB, ELISA, IHC (p), IF Wirt: Maus Monoclonal 2C9 unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 1-313) antibodyPIM1 Reaktivität: Human ELISA, IHC (p), IF Wirt: Maus Monoclonal 3F5 unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 129-268) antibodyPIM1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 25-86) antibodyPIM1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Pim-1 Oncogene (PIM1) (AA 343-372), (C-Term) antibodyPIM1 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB34666 unconjugated
-
- Applikationshinweise
- The stated application concentrations are suggested starting amounts. Titration of the PIM-1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the PIM-1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- PIM1 (Pim-1 Oncogene (PIM1))
- Andere Bezeichnung
- PIM-1 (PIM1 Produkte)
- Synonyme
- PIM antikoerper, Pim-1 antikoerper, PIM1 antikoerper, pim antikoerper, pim-1 antikoerper, pim3 antikoerper, Pim-1 proto-oncogene, serine/threonine kinase antikoerper, proviral integration site 1 antikoerper, Pim-1 proto-oncogene, serine/threonine kinase L homeolog antikoerper, PIM1 antikoerper, Pim1 antikoerper, pim1 antikoerper, pim1.L antikoerper
- Hintergrund
- Proto-oncogene serine/threonine-protein kinase PIM-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, It has also been found to be highly expressed in cell cultures isolated from human tumors. PIM-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM-1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. It also has a role in cardioprotection downstream of AKT activation.
- Gen-ID
- 5292
- Pathways
- Glycosaminoglycan Metabolic Process
-
