ERBB3 Antikörper

Produktnummer ABIN2779309

Produktdetails anti-ERBB3 Antikörper

Target: ERBB3 (Receptor Tyrosine-Protein Kinase ErbB-3 (ERBB3))

Reaktivität: Human, Maus, Ratte, Rind (Kuh), Pferd, Meerschweinchen

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERBB3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC)

Sequenz: GLLFSLARGS EVGNSQAVCP GTLNGLSVTG DAENQYQTLY KLYERCEVVM

Homologie: Cow: 92%, Guinea Pig: 100%, Horse: 92%, Human: 100%, Mouse: 92%, Rat: 92%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM

Anwendungsinformationen

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeat freeze-thaw cycles.

Lagerung: -20 °C

Informationen zur Lagerung: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Details zu ERBB3

Target: ERBB3 (Receptor Tyrosine-Protein Kinase ErbB-3 (ERBB3))

Andere Bezeichnung: ERBB3 (ERBB3 Produkte)

Synonyme: ErbB-3 antikoerper, HER3 antikoerper, LCCS2 antikoerper, MDA-BF-1 antikoerper, c-erbB-3 antikoerper, c-erbB3 antikoerper, erbB3-S antikoerper, p180-ErbB3 antikoerper, p45-sErbB3 antikoerper, p85-sErbB3 antikoerper, ERBB3 antikoerper, C76256 antikoerper, Erbb-3 antikoerper, Erbb3r antikoerper, Her3 antikoerper, nuc-ErbB3 antikoerper, erb-b2 receptor tyrosine kinase 3 antikoerper, v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) antikoerper, ERBB3 antikoerper, Erbb3 antikoerper

Hintergrund: This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Alias Symbols: HER3, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3,
Protein Interaction Partner: PA2G4, UBC, NEDD4, JAK3, JAK2, ITK, HSP90AA1, HCK, GRB7, FGFR1, FER, PIK3R2, PIK3R1, NCK1, SH2D1A, TNS4, TNS3, SHC3, DAPP1, TENC1, VAV3, SH2B3, RIN1, PIK3R3, NCK2, BCAR3, ZAP70, VAV2, VAV1, TXK, SYK, SRC, SHC1, RASA1, PTK6, PLCG1, DAB1, CRKL, CRK, CHN2, A
Protein Size: 1342

Molekulargewicht: 148 kDa

Gen-ID: 2065

NCBI Accession: NM_001005915, NP_001973

UniProt: P21860

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung