ENO2/NSE Antikörper (AA 2-285)
-
- Target Alle ENO2/NSE (ENO2) Antikörper anzeigen
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
-
Bindungsspezifität
- AA 2-285
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ENO2/NSE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Verwendungszweck
- Polyclonal Antibody to Enolase, Neuron Specific (NSE)
- Spezifität
- The antibody is a rabbit polyclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.
- Kreuzreaktivität
- Maus, Ratte
- Aufreinigung
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogen
- Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag
- Isotyp
- IgG
- Top Product
- Discover our top product ENO2 Primärantikörper
-
-
- Applikationshinweise
-
Western blotting: 0.5-2 μg/mL
Immunohistochemistry: 5-20 μg/mL
Immunocytochemistry: 5-20 μg/mL
Optimal working dilutions must be determined by end user.
- Kommentare
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.
- Konservierungsmittel
- ProClin
- Vorsichtsmaßnahmen
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handhabung
- Avoid repeated freeze-thaw cycles.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Haltbarkeit
- 24 months
-
- Target
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Andere Bezeichnung
- Enolase, Neuron Specific (ENO2 Produkte)
- Synonyme
- ENO2 antikoerper, DKFZp459B1817 antikoerper, NSE antikoerper, AI837106 antikoerper, D6Ertd375e antikoerper, Eno-2 antikoerper, RNEN3 antikoerper, eno3 antikoerper, wu:fc09h05 antikoerper, zgc:92418 antikoerper, enolase 2 antikoerper, enolase 2 (gamma, neuronal) antikoerper, enolase 2, gamma neuronal antikoerper, enolase 2, gamma, neuronal antikoerper, ENO2 antikoerper, Eno2 antikoerper, eno2 antikoerper
- Hintergrund
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
-