ENO2/NSE Antikörper (AA 2-285)
-
- Target Alle ENO2/NSE (ENO2) Antikörper anzeigen
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
-
Bindungsspezifität
- AA 2-285
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser ENO2/NSE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Verwendungszweck
- Monoclonal Antibody to Enolase, Neuron Specific (NSE)
- Spezifität
- The antibody is a mouse monoclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.
- Kreuzreaktivität
- Maus, Ratte
- Aufreinigung
- Protein A + Protein G affinity chromatography
- Immunogen
- Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag
- Klon
- C3
- Isotyp
- IgG2b kappa
- Top Product
- Discover our top product ENO2 Primärantikörper
-
-
- Applikationshinweise
-
Western blotting: 0.5-2 μg/mL
1:500-2000 Immunohistochemistry: 5-20 μg/mL
1:50-200 Immunocytochemistry: 5-20 μg/mL
1:50-200 Optimal working dilutions must be determined by end user.
- Kommentare
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Haltbarkeit
- 24 months
-
- Target
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Andere Bezeichnung
- Enolase, Neuron Specific (ENO2 Produkte)
- Synonyme
- ENO2 antikoerper, DKFZp459B1817 antikoerper, NSE antikoerper, AI837106 antikoerper, D6Ertd375e antikoerper, Eno-2 antikoerper, RNEN3 antikoerper, eno3 antikoerper, wu:fc09h05 antikoerper, zgc:92418 antikoerper, enolase 2 antikoerper, enolase 2 (gamma, neuronal) antikoerper, enolase 2, gamma neuronal antikoerper, enolase 2, gamma, neuronal antikoerper, ENO2 antikoerper, Eno2 antikoerper, eno2 antikoerper
- Hintergrund
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
-