CD59 Antikörper (AA 25-104)
-
- Target Alle CD59 Antikörper anzeigen
- CD59
-
Bindungsspezifität
- AA 25-104
-
Reaktivität
- Kaninchen
-
Wirt
-
Meerschweinchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD59 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Sequenz
- MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-SLMCYH CLLPSPNCST VTNCTPNHDA CLTAVSGPRV YRQCWRYEDC NFEFISNRLE ENSLKYNCCR KDLCNGPEDD GTAL
- Spezifität
- It has been selected for its ability to recognize CD59 in immunohistochemical staining and Western blotting.
- Aufreinigung
- Affinity Chromatography
- Immunogen
- CD59 (AA 25-104)
- Isotyp
- IgG
- Top Product
- Discover our top product CD59 Primärantikörper
-
-
- Applikationshinweise
-
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user. - Kommentare
-
Content: The quality control contains recombinant CD59 (Ser25~Leu104) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % . - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handhabung
- Avoid repeated freeze/thaw cycles
- Lagerung
- 4 °C
- Informationen zur Lagerung
- Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
- Haltbarkeit
- 12 months
-
- Target
- CD59
- Andere Bezeichnung
- Protectin (CD59) (CD59 Produkte)
- Synonyme
- 16.3A5 antikoerper, 1F5 antikoerper, EJ16 antikoerper, EJ30 antikoerper, EL32 antikoerper, G344 antikoerper, HRF-20 antikoerper, HRF20 antikoerper, MAC-IP antikoerper, MACIF antikoerper, MEM43 antikoerper, MIC11 antikoerper, MIN1 antikoerper, MIN2 antikoerper, MIN3 antikoerper, MIRL antikoerper, MSK21 antikoerper, p18-20 antikoerper, Cd59a antikoerper, Cd59b antikoerper, MACIP antikoerper, CD59 molecule (CD59 blood group) antikoerper, CD59 molecule antikoerper, CD59 antikoerper, Cd59 antikoerper
- Pathways
- Komplementsystem
-