anti-Human STRADA Antikörper für Immunohistochemistry

Recommended STRADA Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
STE20-Related Kinase Adaptor alpha (STRADA) Antikörper
  • fj99g05
  • zgc:56109
  • wu:fj99g05
  • lyk5
  • LYK5
  • NY-BR-96
  • PMSE
  • STRAD
  • Stlk
  • Lyk5
  • 2610019A05Rik
  • 6030402H20Rik
  • AI480680
  • E130112C09Rik
  • STE20-related kinase adaptor alpha
  • ste20-related kinase adaptor alpha
  • STRADA
  • strada
  • Strada
Reaktivität
Human
104
41
19
7
3
2
2
2
2
1
1
Wirt
Kaninchen
99
5
Klonalität
Polyklonal
Konjugat
Dieser STRADA Antikörper ist unkonjugiert
7
7
5
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
91
52
13
12
11
8
7
4
3
2
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4331946
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN3187102 ELISA IHC WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4331947 ICC IF IHC IHC (p) WB Rabbit IgG Center Anmelden zum Anzeigen Polyclonal 0
1 ABIN599607 ELISA IHC IHC (p) WB Mouse IgG2a, kappa AA 251-347 Anmelden zum Anzeigen 4E4 0
1 ABIN2750473 ELISA IHC IP WB FITC Rabbit IgG AA 50-100, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2572985 FACS IF IHC IHC (p) WB Rabbit AA 303-346 Anmelden zum Anzeigen Polyclonal 0
1 ABIN6098890 ELISA IHC WB Rabbit IgG AA 25-210 Anmelden zum Anzeigen Polyclonal 0
1 ABIN6101881 ELISA IHC WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN6095785 ELISA IHC Rabbit IgG AA 25-210 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2368491 IHC ELISA WB Mouse IgG2a kappa AA 251-347 Anmelden zum Anzeigen 4E4 0
1 ABIN2747581 ELISA IHC IP WB Rabbit IgG AA 50-100, N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5558755 ELISA IHC IP WB Biotin Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5928311 ELISA IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 0

General

Antigen STE20-Related Kinase Adaptor alpha (STRADA) Antikörper
Reaktivität Human
(104), (41), (19), (7), (3), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(99), (5)
Klonalität
Polyklonal
Konjugat Dieser STRADA Antikörper ist unkonjugiert
(7), (7), (5), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(91), (52), (13), (12), (11), (8), (7), (4), (3), (2), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-STRADA Antikörper

Target Details STRADA Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSG
Isotyp IgG
Plasmids, Primers & others

Target Details STRADA

Produktdetails anti-STRADA Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung LYK5 (STRADA Antibody Abstract)
Hintergrund Gene Symbol: STRADA
Gen-ID 92335
Pathways AMPK Signaling

Anwendungsinformationen

Produktdetails anti-STRADA Antikörper Target Details STRADA Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-STRADA Antikörper Target Details STRADA Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-STRADA Antikörper Target Details STRADA Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-STE20-Related Kinase Adaptor alpha (STRADA) antibody (ABIN4331946) Immunocytochemistry/Immunofluorescence: LYK5 Antibody [NBP1-89577] - Staining of huma...
Immunohistochemistry (IHC) image for anti-STE20-Related Kinase Adaptor alpha (STRADA) antibody (ABIN4331946) Immunohistochemistry: LYK5 Antibody [NBP1-89577] - Staining of human duodenum shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-STE20-Related Kinase Adaptor alpha (STRADA) antibody (ABIN4331946) Immunohistochemistry-Paraffin: LYK5 Antibody [NBP1-89577] - Staining of human duodenu...