anti-Maus NR3C2 Antikörper für Western Blotting

Recommended NR3C2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2) Antikörper
  • mr
  • si:ch211-189l17.1
  • LOC100302443
  • NR3C2
  • LOC443144
  • MLR
  • MR
  • MCR
  • NR3C2VIT
  • Mlr
  • mlr
  • nuclear receptor subfamily 3, group C, member 2
  • nuclear receptor subfamily 3 group C member 2
  • mineralocorticoid receptor
  • nuclear receptor subfamily 3 group C member 2 L homeolog
  • nr3c2
  • NR3C2
  • LOC443144
  • Nr3c2
  • nr3c2.L
Epitop
AA 950-984, C-Term
18
7
7
4
3
3
3
3
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
86
45
43
17
17
14
7
5
3
3
2
1
1
Wirt
Kaninchen
67
21
Klonalität
Polyklonal
Konjugat
Dieser NR3C2 Antikörper ist unkonjugiert
3
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
71
25
24
18
16
14
14
13
7
6
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043575
$ 240.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.235929 ABIN735353 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 1
12.137056 ABIN6390076 ELISA WB Rabbit IgG AA 10-90 Anmelden zum Anzeigen Polyclonal 0
10.3938465 ABIN152721 BP FACS ICC IF IHC IHC (p) Neut WB Mouse IgG1 Anmelden zum Anzeigen H10E4C9F 1
7.735928 ABIN2773864 IHC WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
4.735928 ABIN2777197 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 1
4.735928 ABIN2792564 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
4.735928 ABIN3032062 WB Rabbit IgG AA 966-984 Anmelden zum Anzeigen Polyclonal 0
4 ABIN477319 WB Rabbit IgG N-Term Anmelden zum Anzeigen Polyclonal 0
4 ABIN470434 WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2625400 WB Rabbit IgG AA 966-984 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2880610 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN735362 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN735355 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2917892 ELISA IF/ICC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1089579 IF ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN2442833 WB Rabbit N-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4951773 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN5871876 ELISA IF/ICC IHC IP WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
-12.842082 ABIN4334539 FACS ICC IF IHC IHC (p) WB DyLight 405 Mouse IgG1 Anmelden zum Anzeigen H10E4C9F 0
-12.842082 ABIN4334549 FACS ICC IF IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 Anmelden zum Anzeigen H10E4C9F 0

General

Antigen Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2) Antikörper
Epitop AA 950-984, C-Term
(18), (7), (7), (4), (3), (3), (3), (3), (2), (2), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(86), (45), (43), (17), (17), (14), (7), (5), (3), (3), (2), (1), (1)
Wirt Kaninchen
(67), (21)
Klonalität
Polyklonal
Konjugat Dieser NR3C2 Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(71), (25), (24), (18), (16), (14), (14), (13), (7), (6), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-NR3C2 Antikörper

Target Details NR3C2 Anwendungsinformationen Handhabung Referenzen für anti-NR3C2 Antikörper (ABIN3043575) Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.
Sequenz HALKVEFPAM LVEIISDQLP KVESGNAKPL YFHRK
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: nuclear receptor subfamily 3, group C, member 2
Protein Name: Mineralocorticoid receptor
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Isotyp IgG
Plasmids, Primers & others

Target Details NR3C2

Produktdetails anti-NR3C2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-NR3C2 Antikörper (ABIN3043575) Bilder zurück nach oben
Antigen
Andere Bezeichnung NR3C2 (NR3C2 Antibody Abstract)
Hintergrund NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

Synonyms: Aldosterone receptor antibody|MCR antibody|MCR_HUMAN antibody|MGC133092 antibody| Mineralocorticoid receptor antibody|MLR antibody|MR antibody|NR3 C2 antibody|NR3C2 antibody|NR3C2 protein antibody|Nuclear receptor subfamily 3 group C member 2 antibody
Gen-ID 4306
UniProt P08235
Pathways ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway

Anwendungsinformationen

Produktdetails anti-NR3C2 Antikörper Target Details NR3C2 Handhabung Referenzen für anti-NR3C2 Antikörper (ABIN3043575) Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-NR3C2 Antikörper Target Details NR3C2 Anwendungsinformationen Referenzen für anti-NR3C2 Antikörper (ABIN3043575) Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-NR3C2 Antikörper (ABIN3043575)

Produktdetails anti-NR3C2 Antikörper Target Details NR3C2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Rigiracciolo, Scarpelli, Lappano, Pisano, Santolla, Avino, De Marco, Bussolati, Maggiolini, De Francesco: "GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells." in: Oncotarget, Vol. 7, Issue 1, pp. 94-111, 2016

Bilder

Produktdetails anti-NR3C2 Antikörper Target Details NR3C2 Anwendungsinformationen Handhabung Referenzen für anti-NR3C2 Antikörper (ABIN3043575) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2) (AA 950-984), (C-Term) antibody (ABIN3043575) anti-Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2) (AA 950-984), (C-Term) antibody
Western Blotting (WB) image for anti-Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2) (AA 950-984), (C-Term) antibody (ABIN3043575) Western blot analysis of NR3C2 using anti- NR3C2 antibody . Electrophoresis was perf...