NR3C2 Antikörper (C-Term)

Produktnummer ABIN3043575

Produktdetails anti-NR3C2 Antikörper

Target: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Bindungsspezifität: AA 950-984, C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR3C2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: HALKVEFPAM LVEIISDQLP KVESGNAKPL YFHRK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Mineralocorticoid receptor(NR3C2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: nuclear receptor subfamily 3, group C, member 2
Protein Name: Mineralocorticoid receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-NR3C2 Antikörper (ABIN3043575)

Rigiracciolo, Scarpelli, Lappano, Pisano, Santolla, Avino, De Marco, Bussolati, Maggiolini, De Francesco: "GPER is involved in the stimulatory effects of aldosterone in breast cancer cells and breast tumor-derived endothelial cells." in: Oncotarget, Vol. 7, Issue 1, pp. 94-111, (2016) (PubMed).

Details zu NR3C2

Target: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Andere Bezeichnung: NR3C2 (NR3C2 Produkte)

Synonyme: mr antikoerper, si:ch211-189l17.1 antikoerper, LOC100302443 antikoerper, NR3C2 antikoerper, LOC443144 antikoerper, MLR antikoerper, MR antikoerper, MCR antikoerper, NR3C2VIT antikoerper, Mlr antikoerper, mlr antikoerper, nuclear receptor subfamily 3, group C, member 2 antikoerper, nuclear receptor subfamily 3 group C member 2 antikoerper, mineralocorticoid receptor antikoerper, nuclear receptor subfamily 3 group C member 2 L homeolog antikoerper, nr3c2 antikoerper, NR3C2 antikoerper, LOC443144 antikoerper, Nr3c2 antikoerper, nr3c2.L antikoerper

Hintergrund: NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

Synonyms: Aldosterone receptor antibody|MCR antibody|MCR_HUMAN antibody|MGC133092 antibody| Mineralocorticoid receptor antibody|MLR antibody|MR antibody|NR3 C2 antibody|NR3C2 antibody|NR3C2 protein antibody|Nuclear receptor subfamily 3 group C member 2 antibody

Gen-ID: 4306

UniProt: P08235

Pathways: ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway