anti-Maus Kininogen 1 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Kininogen 1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Kininogen 1 (KNG1) Antikörper
  • BDK
  • BK
  • KNG
  • Kng
  • KNG2
  • fb64g01
  • wu:fb64g01
  • zgc:103569
  • kininogen
  • bdk
  • kng
  • KNG1
  • KINKG
  • KINKH
  • Kng1
  • Kngk
  • kininogen 1
  • kininogen 1 L homeolog
  • kininogen 2-like 1
  • KNG1
  • Kng1
  • kng1
  • kng1.L
  • Kng2l1
Epitop
AA 227-259, Middle Region
21
13
11
9
8
8
8
6
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Reaktivität
Maus
147
25
24
4
4
2
2
1
1
1
1
1
Wirt
Kaninchen
132
28
21
Klonalität
Polyklonal
Konjugat
Unkonjugiert
12
10
9
4
4
4
2
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
138
99
67
21
20
17
14
9
6
5
4
2
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043285
$ 280.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1493884 IHC IHC (p) WB Rabbit IgG AA 251-300 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1822181 IF IHC IHC (p) Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN1862825 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN4950357 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Kininogen 1 (KNG1) Antikörper
Epitop AA 227-259, Middle Region
(21), (13), (11), (9), (8), (8), (8), (6), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Maus
(147), (25), (24), (4), (4), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(132), (28), (21)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(12), (10), (9), (4), (4), (4), (2)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(138), (99), (67), (21), (20), (17), (14), (9), (6), (5), (4), (2), (2), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.
Sequenz ECRGNLFMDI NNKIANFSQS CTLYSGDDLV EA
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.
Gene Name: kininogen 1
Protein Name: Kininogen-1
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung KNG1 (KNG1 Antibody Abstract)
Hintergrund Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins - high - molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.

Synonyms: Alpha-2-thiol proteinase inhibitor antibody|BDK antibody|BK antibody|Bradykinin antibody|Fitzgerald factor antibody|High molecular weight kininogen antibody|HMWK antibody|Ile-Ser-Bradykinin antibody|Kallidin I antibody|Kallidin II antibody|Kininogen antibody|KNG antibody|KNG1 antibody|KNG1_HUMAN antibody|Low molecular weight growth-promoting factor antibody|Williams-Fitzgerald-Flaujeac factor antibody
Gen-ID 16644
UniProt O08677
Pathways ACE Inhibitor Pathway, Glycosaminoglycan Metabolic Process

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Kininogen 1 (KNG1) (AA 227-259), (Middle Region) antibody (ABIN3043285) anti-Kininogen 1 (KNG1) (AA 227-259), (Middle Region) antibody
Immunohistochemistry (IHC) image for anti-Kininogen 1 (KNG1) (AA 227-259), (Middle Region) antibody (ABIN3043285) Anti- Kininogen 1 Picoband antibody, IHC(P) IHC(P): Mouse Kidney Tissue