anti-Human Ephrin A5 Antikörper für Immunocytochemistry

Recommended Ephrin A5 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ephrin A5 (EFNA5) Antikörper
  • EFNA5
  • af1
  • efl5
  • rags
  • eplg7
  • lerk7
  • AL-1
  • AV158822
  • EFL-5
  • Ephrin-A5
  • Epl7
  • LERK-7
  • RAGS
  • Lerk7
  • AF1
  • EFL5
  • EPLG7
  • GLC1M
  • LERK7
  • ephrin-A5-like
  • ephrin-A5
  • ephrin A5
  • LOC100073202
  • EFNA5
  • efna5
  • LOC100228846
  • Efna5
  • LOC100358004
  • LOC100513721
Reaktivität
Human
62
48
43
9
8
6
5
5
4
3
2
2
2
1
1
Wirt
Kaninchen
57
9
5
1
Klonalität
Polyklonal
Konjugat
Dieser Ephrin A5 Antikörper ist unkonjugiert
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
49
35
17
15
14
13
4
3
3
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076560
335,00 €
Zzgl. Versandkosten 20,00 € und MWSt
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1867697 ICC IHC IP WB Rabbit IgG AA 21-203 Anmelden zum Anzeigen Polyclonal
1 ABIN2740477 FACS ICC IF IHC (p) WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2857564 ICC IF IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

anti-Ephrin A5 Antikörper für Immunocytochemistry mit den meisten Publikationen

  • Human Polyclonal Ephrin A5 Primary Antibody für ICC, IF - ABIN5076560 (1 Publications): Andretta, Cartón-García, Martínez-Barriocanal, de Marcondes, Jimenez-Flores, Macaya, Bazzocco, Bilic, Rodrigues, Nieto, Landolfi, Ramon Y Cajal, Schwartz, Brown, Dopeso, Arango: Investigation of the role of tyrosine kinase receptor EPHA3 in colorectal cancer. in Scientific reports 2017 (PubMed)

Ähnliche anti-Ephrin A5 Antikörper

Applikation / Reaktivität Human
ELISA 27 Antikörper
Flow Cytometry (FACS) 3 Antikörper
Immunochromatography (IC) 1 Antikörper
Immunocytochemistry (ICC) 4 Antikörper
Immunofluorescence (IF) 15 Antikörper
Immunofluorescence (fixed cells) (IF/ICC) 4 Antikörper
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antikörper
Immunohistochemistry (IHC) 17 Antikörper
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antikörper
Immunoprecipitation (IP) 2 Antikörper
Western Blotting (WB) 40 Antikörper

General

Antigen Ephrin A5 (EFNA5) Antikörper
Reaktivität Human
(62), (48), (43), (9), (8), (6), (5), (5), (4), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(57), (9), (5), (1)
Klonalität
Polyklonal
Konjugat Dieser Ephrin A5 Antikörper ist unkonjugiert
(3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(49), (35), (17), (15), (14), (13), (4), (3), (3), (3), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Ephrin A5 Antikörper

Target Details Ephrin A5 Anwendungsinformationen Handhabung ProductDetails: References for anti-Ephrin A5 antibody (ABIN5076560) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Isotyp IgG

Target Details Ephrin A5

Produktdetails anti-Ephrin A5 Antikörper Anwendungsinformationen Handhabung ProductDetails: References for anti-Ephrin A5 antibody (ABIN5076560) Bilder zurück nach oben
Antigen
Andere Bezeichnung Ephrin-A5 (EFNA5 Antibody Abstract)
Hintergrund Gene Symbol: EFNA5
Gen-ID 1946
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Handhabung ProductDetails: References for anti-Ephrin A5 antibody (ABIN5076560) Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Anwendungsinformationen ProductDetails: References for anti-Ephrin A5 antibody (ABIN5076560) Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-Ephrin A5 antibody (ABIN5076560)

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Andretta, Cartón-García, Martínez-Barriocanal, de Marcondes, Jimenez-Flores, Macaya, Bazzocco, Bilic, Rodrigues, Nieto, Landolfi, Ramon Y Cajal, Schwartz, Brown, Dopeso, Arango: "Investigation of the role of tyrosine kinase receptor EPHA3 in colorectal cancer." in: Scientific reports, Vol. 7, pp. 41576, 2017 Von den Autoren verwendete Methode: Western Blotting (WB) (Probematerial (Species): Mouse (Murine)).

Bilder

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Anwendungsinformationen Handhabung ProductDetails: References for anti-Ephrin A5 antibody (ABIN5076560) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Ephrin A5 Antikörper (EFNA5) (ABIN5076560) Immunocytochemistry/Immunofluorescence: Ephrin-A5 Antibody - Staining of human cell ...