anti-Human Ephrin A5 Antikörper für Immunocytochemistry

Recommended Ephrin A5 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Ephrin A5 (EFNA5) Antikörper
  • EFNA5
  • af1
  • efl5
  • rags
  • eplg7
  • lerk7
  • AL-1
  • AV158822
  • EFL-5
  • Ephrin-A5
  • Epl7
  • LERK-7
  • RAGS
  • Lerk7
  • AF1
  • EFL5
  • EPLG7
  • GLC1M
  • LERK7
  • ephrin-A5-like
  • ephrin-A5
  • ephrin A5
  • LOC100073202
  • EFNA5
  • efna5
  • LOC100228846
  • Efna5
  • LOC100358004
  • LOC100513721
Reaktivität
Human
62
48
43
9
8
6
5
5
4
3
2
2
2
1
1
Wirt
Kaninchen
57
9
5
1
Klonalität
Polyklonal
Konjugat
Dieser Ephrin A5 Antikörper ist unkonjugiert
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
49
35
17
15
14
13
4
3
3
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5076560
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN1867697 ICC IHC IP WB Rabbit IgG AA 21-203 Anmelden zum Anzeigen Polyclonal
1 ABIN2740477 FACS ICC IF IHC (p) WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal
1 ABIN2857564 ICC IF IHC WB Rabbit Anmelden zum Anzeigen Polyclonal

General

Antigen Ephrin A5 (EFNA5) Antikörper
Reaktivität Human
(62), (48), (43), (9), (8), (6), (5), (5), (4), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(57), (9), (5), (1)
Klonalität
Polyklonal
Konjugat Dieser Ephrin A5 Antikörper ist unkonjugiert
(3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(49), (35), (17), (15), (14), (13), (4), (3), (3), (3), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Ephrin A5 Antikörper

Target Details Ephrin A5 Anwendungsinformationen Handhabung Referenzen für anti-Ephrin A5 Antikörper (ABIN5076560) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Isotyp IgG

Target Details Ephrin A5

Produktdetails anti-Ephrin A5 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-Ephrin A5 Antikörper (ABIN5076560) Bilder zurück nach oben
Antigen
Andere Bezeichnung Ephrin-A5 (EFNA5 Antibody Abstract)
Hintergrund Gene Symbol: EFNA5
Gen-ID 1946
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Handhabung Referenzen für anti-Ephrin A5 Antikörper (ABIN5076560) Bilder zurück nach oben
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Anwendungsinformationen Referenzen für anti-Ephrin A5 Antikörper (ABIN5076560) Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-Ephrin A5 Antikörper (ABIN5076560)

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Andretta, Cartón-García, Martínez-Barriocanal, de Marcondes, Jimenez-Flores, Macaya, Bazzocco, Bilic, Rodrigues, Nieto, Landolfi, Ramon Y Cajal, Schwartz, Brown, Dopeso, Arango: "Investigation of the role of tyrosine kinase receptor EPHA3 in colorectal cancer." in: Scientific reports, Vol. 7, pp. 41576, 2017 Von den Autoren verwendete Methode: Western Blotting (WB) (Probematerial (Species): Mouse (Murine)).

Bilder

Produktdetails anti-Ephrin A5 Antikörper Target Details Ephrin A5 Anwendungsinformationen Handhabung Referenzen für anti-Ephrin A5 Antikörper (ABIN5076560) zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Ephrin A5 (EFNA5) antibody (ABIN5076560) Immunocytochemistry/Immunofluorescence: Ephrin-A5 Antibody - Staining of human cell ...