anti-Human TANK-Binding Kinase 1 Antikörper für Immunofluorescence

Recommended TANK-Binding Kinase 1 Antibody (geliefert von: Anmelden zum Anzeigen )

TANK-Binding Kinase 1 (TBK1) Antikörper
  • nak
  • t2k
  • TBK1
  • wu:fk70c05
  • zgc:136548
  • NAK
  • T2K
  • 1200008B05Rik
  • AI462036
  • AW048562
  • TANK binding kinase 1 L homeolog
  • TANK binding kinase 1
  • TANK-binding kinase 1
  • tbk1.L
  • TBK1
  • tbk1
  • Tbk1
Immunocytochemistry (ICC), Immunofluorescence (IF)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN5080004
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN252648 ICC IF IHC IHC (p) SimWes WB Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 22
1 ABIN5555030 EIA IF WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN4358028 ICC IF IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358029 ICC IF IHC IHC (p) WB Alexa Fluor 488 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358030 ICC IF IHC IHC (p) WB Alexa Fluor 647 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358031 ICC IF IHC IHC (p) WB Alexa Fluor 700 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358017 ICC IF IHC IHC (p) WB Biotin Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358025 ICC IF IHC IHC (p) WB DyLight 350 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358026 ICC IF IHC IHC (p) WB DyLight 405 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358018 ICC IF IHC IHC (p) WB DyLight 650 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358014 ICC IF IHC IHC (p) SimWes WB Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358020 ICC IF IHC IHC (p) WB DyLight 488 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358024 ICC IF IHC IHC (p) WB DyLight 550 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358019 ICC IF IHC IHC (p) WB DyLight 680 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358021 ICC IF IHC IHC (p) WB DyLight 755 Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0
1 ABIN4358032 ICC IF IHC IHC (p) WB Mouse IgG1 kappa Anmelden zum Anzeigen 108A429 0


Antigen TANK-Binding Kinase 1 (TBK1) Antikörper
Reaktivität Human
(133), (87), (50), (30), (29), (10), (10), (9), (8), (5), (5), (4), (3), (2), (2), (2), (2), (1), (1)
Wirt Kaninchen
(102), (37), (13)
Konjugat Unkonjugiert
(10), (10), (9), (8), (6), (5), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(134), (65), (63), (34), (23), (16), (9), (6), (3), (2), (2), (2), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVV
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung TBK1 (TBK1 Antibody Abstract)
Hintergrund Gene Symbol: TBK1
Gen-ID 29110
Pathways TLR Signalweg, Activation of Innate immune Response, Hepatitis C, Toll-Like Receptors Cascades


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-TANK-Binding Kinase 1 (TBK1) antibody (ABIN5080004) Immunocytochemistry/Immunofluorescence: TBK1 Antibody - Staining of human cell line ...