anti-Human G Protein-Coupled Receptor 1 Antikörper für Immunocytochemistry

Recommended G Protein-Coupled Receptor 1 Antibody (geliefert von: Anmelden zum Anzeigen )

G Protein-Coupled Receptor 1 (GPR1) Antikörper
  • F11A17.17
  • F11A17_17
  • G-protein-coupled receptor 1
  • G protein-coupled receptor GPR1
  • G protein-coupled receptor 1
  • G-protein-coupled receptor 1
  • TVAG_065230
  • Bm1_20935
  • GPR1
  • Gpr1
  • GCR1
Dieser G Protein-Coupled Receptor 1 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4315554
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
1 ABIN5579015 ICC IHC (p) Rabbit Anmelden zum Anzeigen Polyclonal


Antigen G Protein-Coupled Receptor 1 (GPR1) Antikörper
Reaktivität Human
(56), (19), (19), (3), (2), (1), (1)
Wirt Kaninchen
(52), (4)
Konjugat Dieser G Protein-Coupled Receptor 1 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(29), (13), (9), (8), (6), (5), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-G Protein-Coupled Receptor 1 Antikörper

Target Details G Protein-Coupled Receptor 1 Anwendungsinformationen Handhabung Referenzen für anti-G Protein-Coupled Receptor 1 Antikörper (ABIN4315554) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Isotyp IgG

Target Details G Protein-Coupled Receptor 1

Produktdetails anti-G Protein-Coupled Receptor 1 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-G Protein-Coupled Receptor 1 Antikörper (ABIN4315554) Bilder zurück nach oben
Andere Bezeichnung GPR1 (GPR1 Antibody Abstract)
Hintergrund Gene Symbol: GPR1
Gen-ID 2825
Pathways Steroid Hormone Mediated Signaling Pathway, Regulation of Carbohydrate Metabolic Process


Produktdetails anti-G Protein-Coupled Receptor 1 Antikörper Target Details G Protein-Coupled Receptor 1 Handhabung Referenzen für anti-G Protein-Coupled Receptor 1 Antikörper (ABIN4315554) Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-G Protein-Coupled Receptor 1 Antikörper Target Details G Protein-Coupled Receptor 1 Anwendungsinformationen Referenzen für anti-G Protein-Coupled Receptor 1 Antikörper (ABIN4315554) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-G Protein-Coupled Receptor 1 Antikörper (ABIN4315554)

Produktdetails anti-G Protein-Coupled Receptor 1 Antikörper Target Details G Protein-Coupled Receptor 1 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011


Produktdetails anti-G Protein-Coupled Receptor 1 Antikörper Target Details G Protein-Coupled Receptor 1 Anwendungsinformationen Handhabung Referenzen für anti-G Protein-Coupled Receptor 1 Antikörper (ABIN4315554) zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-G Protein-Coupled Receptor 1 (GPR1) antibody (ABIN4315554) Western Blot: GPR1 Antibody [NBP1-87585] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-G Protein-Coupled Receptor 1 (GPR1) antibody (ABIN4315554) Immunohistochemistry-Paraffin: GPR1 Antibody [NBP1-87585] - Staining of human cerebra...
Immunofluorescence (IF) image for anti-G Protein-Coupled Receptor 1 (GPR1) antibody (ABIN4315554) Immunocytochemistry/Immunofluorescence: GPR1 Antibody [NBP1-87585] - Staining of huma...