anti-Human SCO1 Cytochrome C Oxidase Assembly Protein Antikörper für Immunofluorescence

Recommended SCO1 Cytochrome C Oxidase Assembly Protein Antibody (geliefert von: Anmelden zum Anzeigen )

SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) Antikörper
  • Bs
  • CD117
  • Fdc
  • Gsfsco1
  • Gsfsco5
  • Gsfsow3
  • SCO1
  • SCO5
  • SOW3
  • Ssm
  • Tr-kit
  • W
  • c-KIT
  • SCOD1
  • RGD1559538
  • KIT proto-oncogene receptor tyrosine kinase
  • SCO1, cytochrome c oxidase assembly protein
  • SCO1 cytochrome c oxidase assembly protein
  • Kit
  • SCO1
  • Sco1
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4352258
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.114989 ABIN4352257 ELISA ICC IF IHC IHC (p) WB Rabbit Center Anmelden zum Anzeigen Polyclonal
12.114989 ABIN520030 IF WB Mouse AA 1-301, full length Anmelden zum Anzeigen Polyclonal
12.114989 ABIN4352259 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
12.114989 ABIN520031 IF WB Mouse AA 1-301, full length Anmelden zum Anzeigen Polyclonal
1 ABIN2356721 IF IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2356722 IF WB Mouse IgG AA 1-301 Anmelden zum Anzeigen Polyclonal


Antigen SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) Antikörper
Reaktivität Human
(32), (15), (15), (4), (3), (3), (3), (3), (2), (1), (1)
Wirt Kaninchen
(28), (4)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(29), (12), (10), (8), (6), (2), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTG
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Andere Bezeichnung SCO1 (SCO1 Antibody Abstract)
Hintergrund Gene Symbol: SCO1
Gen-ID 6341
Forschungsgebiet Signaling, Metabolism, Organelles
Pathways Sensory Perception of Sound, Transition Metal Ion Homeostasis, Stem Cell Maintenance, Production of Molecular Mediator of Immune Response, Regulation of long-term Neuronal Synaptic Plasticity


Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Rolland, Motori, Memar, Hench, Frank, Winklhofer, Conradt: "Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 110, Issue 32, pp. E2967-76, 2013 (Probematerial (Species): Human). Weitere Details: Western Blotting


Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) antibody (ABIN4352258) Western Blot: SCO1 Antibody [NBP1-87073] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) antibody (ABIN4352258) Immunocytochemistry/Immunofluorescence: SCO1 Antibody [NBP1-87073] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SCO1 Cytochrome C Oxidase Assembly Protein (SCO1) antibody (ABIN4352258) Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human liver s...